uawdijnntqw1x1x1
IP : 216.73.216.86
Hostname : 6.87.74.97.host.secureserver.net
Kernel : Linux 6.87.74.97.host.secureserver.net 4.18.0-553.83.1.el8_10.x86_64 #1 SMP Mon Nov 10 04:22:44 EST 2025 x86_64
Disable Function : None :)
OS : Linux
PATH:
/
home
/
emeraadmin
/
www
/
node_modules
/
tss-react
/
..
/
object.defaults
/
..
/
..
/
4d695
/
rdma.tar
/
/
usr/sbin/rdma000075500000566610151702774650007215 0ustar00ELF>�Y@��@8@@@@hh����W�W �]�]"�]"�k@� ��"�"@@��� ���DDS�td��� P�td��������Q�tdR�td�]�]"�]"P2P2/lib64/ld-linux-x86-64.so.2GNU�GNUGNU~_j=/�na�g%h�-Sg����M!���(�BE�� ���|�qX9�2����xj(i��Q�� Tt�= $��������R���2j|Kb�l�9 ��L���>�[�[�L�A�e%��+ �X����d�- |p����fo�;���4��������+�����/�z'��NTn�e����>�8�tn< ���vM"E9��\�@�"�@�"7X�"��#�@�"!`�"EH�"P�"libselinux.so.1_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTablelibbpf.so.0libelf.so.1libmnl.so.0mnl_attr_nest_endmnl_attr_parse_nestedmnl_attr_type_validmnl_cb_runmnl_attr_get_strmnl_attr_get_u64mnl_attr_get_payloadmnl_socket_closemnl_attr_nextmnl_attr_get_u8mnl_socket_recvfrommnl_socket_get_portidmnl_nlmsg_put_headermnl_attr_put_u8mnl_attr_get_payload_lenmnl_attr_parsemnl_attr_okmnl_attr_put_u32mnl_attr_nest_startmnl_attr_get_u32mnl_socket_sendtomnl_attr_get_typemnl_attr_validatemnl_attr_put_strzlibcap.so.2cap_get_proccap_get_flagcap_clearcap_set_proccap_freemnl_nlmsg_get_payloadmnl_nlmsg_get_payload_lenmnl_attr_get_u16mnl_socket_openmnl_socket_setsockoptmnl_socket_bindmnl_nlmsg_put_extra_headermnl_cb_run2libc.so.6socketfflushstrcpy__printf_chkexitstrncmpoptindstrrchrperrorclosedirftellinet_ntopstrncpy__stack_chk_failputcharmkdirreallocstdinstrtollname_to_handle_atstrpbrkstrspnstrdupinet_ptonstrftime__assert_failstrtodstrtokstrtolisattyfeofstrchrnulfgetscallocstrlensendmemsetstrstrstrcspn__errno_locationmemcmpasctime__fprintf_chkopen_by_handle_atstdoutgethostbyaddrfputcrecvstrtok_rmemcpyfreopen64fclosestrtoulmallocstrcatstrcasecmpopendir__ctype_b_locgetenvsscanfoptargstderr__snprintf_chkoptopt__memset_chkgetuidreadlinkfscanfgetopt_long__strncat_chkif_nametoindexsendmsgstrtoullfilenosethostent__getdelimif_indextonamefwritefreadgettimeofdaygeteuid__memcpy_chk__fread_chklocaltimestrchrgetsockname__vfprintf_chkreaddir64__ctype_tolower_loc__cxa_finalize__sprintf_chkmountfopen64__strcat_chkstrcmprecvmsgstrerror__asprintf_chk__libc_start_mainferrorbasenamesnprintfsysconf_edata__bss_startLIBMNL_1.0GLIBC_2.3GLIBC_2.7GLIBC_2.8GLIBC_2.4GLIBC_2.14GLIBC_2.2.5GLIBC_2.3.4 n `/5�ii �ii ii ii ���%ui 0ti <�]"�Z�]"pZ�]"�]"�]"��^"9� ^"��@^"��`^"���^"���^"���^"��_"��_"��_"��_"�� _"��@_"��H_"�P_"�X_"$�`_".�h_"<�p_"��x_"L��_"^��_"l��_"v��_"���_"���_"���_"���_"���_"���_"���_"���_"���_"���_"��_"�`",�`"?�`"J�`"V�(`"d�0`"z�8`"��@`"��H`"��P`"��X`"��``"��h`"��p`"��x`"���`"���`"���`"���`"���`"���`"���`"���`"��`"���`"5��`"��`"��`"��`" �a"+�a"6�a"?�a"�� a"K�(a"a�0a"l�8a"|�@a"��Ha"��Pa"��Xa"��`a"��ha"��pa"��xa"���a"���a"���a"���a"��a"��a"+��a":��a"C��a"R��a"V��a"\��a"B��a"d��a"j��a"r��a"��b"��b"��b"��b"�� b"R�(b"��0b"��8b"d�@b"��Hb"��`b"�hb"�pb"��xb"��b"��b"��b""��b"���b"0��b";��b"C��b"���b"K��b"O��b"��c"T�c"X� c"\��f"���f"K��f"a��j"b��j"\��j"f��j"K�k"k�k"r� k"��0k"y�@k"��Pk"T��n"b��n"\��n"���n"��o"��o"�� o"��0o"K�@o"��Po"��`o"��po"���o"���r"���r"���r"���r"K�s"X�s"a��v"���v"���v"t��v"��w"K�w"�� w"T��z"���z"���z"K��z"a�{"T�{"a��~"���~"���~"���~"���~"���~"���~"���~"�"�"#�" �"+� "6�("=�0"L�@"��H"��P"��X"��`"��h"��p"���"W��"���"d��"���"���"���"\��"K��"����"��Ѓ"K��"���"���"���" � �"��(�"��@�"��H�"�P�")�X�"E�`�")���"_���"e���"k���"q���"w���"}���"����"����"��Ȉ"��Ј"��؈"���"���"���"Z��"�� �"�(�"�0�"�8�"i�@�"'�H�"/�P�"5�X�":�`�"B�h�"H�p�"N�x�"X���"b���"f���"l���"s���"z���"���"����"��Ȑ"�� �" �"(�"`�@�"��(�"��"0�"`�"8�"@�"H�"��h�"����"`���"����"���"����"b���"����"����"����"����"����"����"���"���"���"����"���"���"���"��" � �" �0�"��"�p�"#�x�"'���",���"1���"5���"����"���"����"����"��"�ȏ"Џ";؏"K�"��"��"�@�"�`�"�H�"�P�"�X�"�X�"`�"h�"p�"x�"��"��"��"��" ��" ��"��"��" ��"ȋ"Ћ"؋"�"�"�"��"�"�"�"�" �"(�"0�"8�"@�" H�"!P�""X�"#`�"$h�"%p�"&x�"'��"(��")��"*��"+��",��"-��".��"/��"0Ȍ"1Ќ"2،"3�"4�"5�"6��"7�"8�"9�":�"< �"=(�">0�"?8�"@@�"AH�"BP�"CX�"D`�"Eh�"Fp�"Gx�"H��"I��"J��"L��"M��"N��"O��"P��"Q��"Rȍ"SЍ"T؍"U�"V�"W�"X��"Y�"Z�"[�"\�"] �"^(�"_0�"`8�"a@�"bH�"cP�"dX�"e`�"fh�"gp�"hx�"i��"j��"k��"l��"m��"n��"o��"p��"q��"rȎ"sЎ"t؎"u�"v�"w�"x��"y�"z�"{�"|�"} �"~(�"0�"�8�"�@�"�H�"�P�"�X�"�`�"�h�"�p�"�x�"���"���"���"���"���"���"���"���H��H��J"H��t��H����52F"�%3F"��h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h ��Q������h ��A������h��1������h��!������h ��������h��������h������h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h��Q������h��A������h��1������h��!������h��������h��������h������h �������h!��������h"�������h#�������h$�������h%�������h&�������h'��q������h(��a������h)��Q������h*��A������h+��1������h,��!������h-��������h.��������h/������h0�������h1��������h2�������h3�������h4�������h5�������h6�������h7��q������h8��a������h9��Q������h:��A������h;��1������h<��!������h=��������h>��������h?������h@�������hA��������hB�������hC�������hD�������hE�������hF�������hG��q������hH��a������hI��Q������hJ��A������hK��1������hL��!������hM��������hN��������hO������hP�������hQ��������hR�������hS�������hT�������hU�������hV�������hW��q������hX��a������hY��Q������hZ��A������h[��1������h\��!������h]��������h^��������h_������h`�������ha��������hb�������hc�������hd�������he�������hf�������hg��q������hh��a������hi��Q������hj��A������hk��1������hl��!������hm��������hn��������ho������hp�������hq��������hr�������hs�������ht�������hu�������hv�������hw��q������hx��a������hy��Q������hz��A������h{��1������h|��!������h}��������h~��������h������h��������h���������h��������h��������h��������h��������h��������h���q������h���a������h���Q������h���A������h���1�������%m="D���%e="D���%]="D���%U="D���%M="D���%E="D���%=="D���%5="D���%-="D���%%="D���%="D���%="D���% ="D���%="D���%�<"D���%�<"D���%�<"D���%�<"D���%�<"D���%�<"D���%�<"D���%�<"D���%�<"D���%�<"D���%�<"D���%�<"D���%�<"D���%�<"D���%�<"D���%�<"D���%}<"D���%u<"D���%m<"D���%e<"D���%]<"D���%U<"D���%M<"D���%E<"D���%=<"D���%5<"D���%-<"D���%%<"D���%<"D���%<"D���% <"D���%<"D���%�;"D���%�;"D���%�;"D���%�;"D���%�;"D���%�;"D���%�;"D���%�;"D���%�;"D���%�;"D���%�;"D���%�;"D���%�;"D���%�;"D���%�;"D���%�;"D���%};"D���%u;"D���%m;"D���%e;"D���%];"D���%U;"D���%M;"D���%E;"D���%=;"D���%5;"D���%-;"D���%%;"D���%;"D���%;"D���% ;"D���%;"D���%�:"D���%�:"D���%�:"D���%�:"D���%�:"D���%�:"D���%�:"D���%�:"D���%�:"D���%�:"D���%�:"D���%�:"D���%�:"D���%�:"D���%�:"D���%�:"D���%}:"D���%u:"D���%m:"D���%e:"D���%]:"D���%U:"D���%M:"D���%E:"D���%=:"D���%5:"D���%-:"D���%%:"D���%:"D���%:"D���% :"D���%:"D���%�9"D���%�9"D���%�9"D���%�9"D���%�9"D���%�9"D���%�9"D���%�9"D���%�9"D���%�9"D���%�9"D���%�9"D���%�9"D���%�9"D���%�9"D���%�9"D���%}9"D���%u9"D���%m9"D���%e9"D���%]9"D���%U9"D���%M9"D���%E9"D���%=9"D���%59"D���%-9"D���%%9"D���%9"D���%9"D��AW�L�= nAVE1�AUATU��SH��H��dH�%(H��$�1�L�d$ L���H�H�>�A����D$ �D$I���D$ H�$�D$E1�H� �"H�މ�H�^m�������E��:��8��Ic�L�>���D$����"��D$ �H�=�q"M��L��1�H��k�����1�H��$�dH3%(�(H�ĸ[]A\A]A^A_��D$ �X���E����D�t$�E���H��q"H�$�5���H� �mL��1�H�5gl���1�뉋 Xq"H�=Yq"H� l1�������_���H� 5q"��H�=5l�O���M��L��H�=�p"H��j1��?��������A������p"�T$8�L�l$0D�|$�D$�D$��A �A�����A ��D$ �D$x�!�"�D$|D���A �I�D$ H�D$@H�D$HI�D$hD�|$8H��$�H��$����� H=�������A��H�D$hH��t&H�T$��L���]L���A�Ņ�tL����1�E�����,����L$H�5� L��L���#A�Ņ�u�H�<$H��t+�t$ L��H�d��A��묿�P���H���_���HcD$��L��H��)��3A�������f���1�I��^H��H���PTL�iH� �hH�=������5"�H�=9o"H�2o"H9�tH��5"H��t �����H�= o"H�5o"H)�H��H��H��?H�H�tH��5"H��t��fD�����=�n"u+UH�=b5"H��tH�=."�y����d�����n"]������w������H��H�OH�=mn"1�H�Lh�I�����1�H���H��I���dH�%(H��$�1�H��A�0H��I�PH�ߎ�H�H�����H� iL��H�D$H�D$H��rH�D$ H�� H�L$H�D$(H���H�D$0H�|*H�D$8H��hH�D$@H�T<H�D$HH��hH�D$PH�cH�D$XH��hH�D$`H��H�D$h� H��$�dH3%(uH�Ę���f.�����H��H������f.�����fD��ATI��_USH���x������x2H���w���H����H��k�4�H�������������x I��[��]A\�fD����f������tH�GH��fD1��D��ATUH��SH����H��I�����I9�wL��H��H��[]A\���[�����]A\�ff.������t ��H�G��ff.���������@�����t&H��H�GH�5]hH�8����H����H���@1��ff.�f���H�GhH��hH9�u�5DH�H9�t(�@ t�SH�xH�� 1�����[�D1��D��AWAVAUATUSH��XH�t$dH�%(H�L$H1�H��� �I������������yH�D$�$E1�HH�D$H�D$;H�D$ H�D$0H�D$(@I�D$�(�N�l0J�,0�D$GH�12345678H�D$;�D$C90,-�'�H��H����L�|$�@H��������tdI��L9|$tI�7H��u�H�=�j"H��1�H�)h����H���L����H�L$HdH3%(��H��X[]A\A]A^A_�@A�Gt%H�t$ L�����L��H�D$��H9D$�H�����L��H�CH�D$���H�T$H��H�CH����H�����8�H�t$(� H���I�����A�GtA�E����E1��D���L�I��H�UH����EH�kH����I9�r�I�D$pI�T$hI�\$pI��H�H�C�$H��$A;$�G�����1�����@H��H�$��H�$H����H���������fDL�D$ H��1�H�=i"H�sf�F���H��������m���@H�D$0�8�����K ����H� �h"�$�H�=f������+���H�GH�=�h"H��e�H�1������������f���AWAVI��AUATL�ghUSH��(H�_hdH�%(H�D$1�H����A��I9�u�DH�L9��|H�kH�{L��H�l$�g�����u�H�D$1�E1�E1�H�D$�D�}E��t6���I��H��DHu[A��-�ED�D�H��H�l$D�}E��uʸ�f�1�H�T$dH3%(�|H��([]A\A]A^A_�H�t$� H����A��A9�t�E9���!�A9��� �u�H�l$�R���f�I9�u�f�H�L9�t�H�{L���|�����u��p�����f���AVI��AUI��ATUSH�_hH�ohH����H9�u�H�mH9���H�}L��������u�H�}�:�I��H����H�5�bH����H��H��t@H�-�bH�����L��I�����I9�uL��H���}���tqH��1����H��H��uǻ�E1�1�L������[]A\A]A^��H9�t_I���fDM�$$I9��@���I�|$L���V�����u��*���D1��@�8H� �e"�H�=�c����I��1��w���f���ATI��`USH������x4H����H�5dH�����,�������xA�,$[�]A\�[�����]A\�fD��ATI���`H����UH��1�SH��dH�%(H��$1�H���H�L��H���i�H�|$H����H�|$��H�|$tg�"�� �I��� �H��H��teL���P�H�CH��tH�E(H�](H�� H�+H�|$H�CH��W�H�|$�C�J�C��"H� �d"�'�H�=hb������H��$dH3%(u"H��[]A\��H�������������@��H����AVAUATUSH��H�HL�s ���H�k L�eM��L9�t/H�EH�}I�D$L� ��H��L����M�$$M��L9�u�H�khH��hL�eM��H9�t=�H�EH�}I�D$L� �[�H�}�R�H��L���G�M�$$M��H9�u�[]A\A]A^�f��ff.�@��AWAVAUATUSH�����tYI��H�oL�5�gL�=5���L��L���u�����t&A�]I�m��t&L�eL����H��L���O�����u�A�]I�m��tH��1�[]A\A]A^A_�fDH� �b"��H�=_���H�����[]A\A]A^A_����AWAVAUATUSH��D�'E��tfL�~L�wH�vI��H��I�H��u�bf.�I��I�7H��tLH�������u�A��I��I�GH��D�eL�uH��[]A\A]A^A_��H�FH��[]A\A]A^A_��@H�=b"I��L��1�H�Z^��(�H��1�[]A\A]A^A_����AUA��ATI��1�UH��S��f��H����I�|$H�E���UI�D$@f�X�PfD�hH��[]A\A]�ff.�@��USH���H���iUH�C8H��tNH�s@H�Nj���Ņ�x1�H����[]ÐH�=)a"���1�H�Y_�T�H�{8�;�H����[]ú#H� �`"�H�=_������ff.���UH��AWAVI��AUI��ATA��SH���H��(dH�%(H�E�1��&�� H=���H�BH��H��H%�H)�H���H��H9�tH��H��$�H9�u�����I������ H=� ���H��H�{8M��M��L��D���)U��x%H�]�dH3%(u\H�e�[A\A]A^A_]���{`u�H�=M\�E��+��E��fD��F�H���)���fDH)�H�L��U�����D��U��SH��H��������tH��[]ÐH����H��H��H�5 �[]���fD��ATUS�1ۅ�tPH�GH����H�8��I�Ą�uHH�] H�� H9�u�Yf�H�H9�tHH�sL���|���u�L����H��[]A\���/H�����H��t���f�1���ff.����AWAVAUA��ATI��UH��SH���X� ��E��u~L�} L�u E��M9�teA�GD��E0A�G��D9�w�=DA�G����9�s*�]4H��A�ԅ�t�$����$H��[]A\A]A^A_�M�?M9�u��1���@�H��E�����D�}A��H��E���EH�EH�8�/���H����P��-���T$H�$��H�t$H�$H�H��Dp������E����H�����S1�D�}E��t A��H�ED�}�C���u4�E09�r(�;���E���/����E4�K���Q�E49�����H��A�ԅ�t�����H��A��E�u-�S1��1�H�y� ��H�$����t\H��t�S9�sHH� �\"��H�=HY���������|���E��u�H��tϋSA�1��-���1����E1������QE1����@��AUATI��UH��SH���X����M��uUH�] L�m L9�u�>fDH�L9�t0�CH��E0A�ԅ�t�D$���D$H��[]A\A]��1���@1�H�����H��t �U��t��H�E�U�@H��E0A��멋U��tH�EH�H�=�["H���1�H�FX���������t���@�����t�����H��H� �["��H�=X�����H���D��H���s�E1�1ҾH� Ҁ�H���@��H������E1�1ҾH� �W�H���t�@���Gu�DATUSH���H���}�H�������H�5��H��� ���t7�E�H�-VrL�d�D�H��1Ҿ�H���D�L9�u�[H�5DW]�A\�:�f.���AWAVAUATUSH��HdH�%(H�D$81��G��I��H����D�W\I��E���(L��E1�E1�����D$H��H�D$,H�D$H�D$0H�D$L����L��H���u�H����H�H)��$����6A��P~ E�g\E����H�t$H������� �D$,M���F���ML���k��H�|$�H�/VH��1���?�����������6����H� �WHc�H�>��f.�H������A�OXH�T$0�����L$��u4H��I��H��U�;H�����A�wXH�T$0���w�L$��������H��I��H��UH�=�X"�1�������H���@�A�XH�T$0A������D$��u=H��H�PU�D�H����E�OXH�T$0A��E�����D$���o���.H��H�UH�=�W"�1��Q���H�|$0������x{A��N@H��� �H�T$0��H��I��H���C��I��1�H� �X��(�H�|$0�n���D$E1�H������H�����H�|$0�F��H�D$8dH3%(��H��H[]A\A]A^A_�A��1ɾ���H�|$0���뒃� u�I���fDH�������D$�y���@L��E1������_����H������m����������fDH��I��H��S����fDH��H��S����4��@��H��hf�H��VdH�%(H�D$X1�H�v)$H��H�D$H�WH�D$H��H�D$H��VH�D$ H�H�D$(H�cVH�D$0H�7)D$@H�D$8��H�L$XdH3%(uH��h����ff.���H��Xf�H�!VdH�%(H�D$H1�H��)$H��H�D$H�]fH�D$H��H�D$H�IfH�D$ H��)D$0H�D$(���H�L$HdH3%(uH��X����fD��H��8f�H��UdH�%(H�D$(1�H��H��)$)D$H�D$��H�L$(dH3%(uH��8����fD��SH��H�OH�;UH�=�T"�1��*�H�K�1�H�=�T"H�AX��H�K�1�H�=�T"H�KX���H�K�1�H�=|T"H�UX���1�[�ff.����H�5�������U����SH��H��dH�%(H�D$1�H�T$�q�S0H�{@����H�{@@�վT�~���t$H����H�L$dH3%(uH��[]��v��fD��1��u���D����b���f���USH��H��(dH�%(H�D$1��n����H�����H�|$�H� �SI��H�Bk1��������H�|$�1��#���Ņ�x}�H��H�T$��v�S0H�{@����H�{@��D����t$H���������H�|$����H�L$dH3%(����H��([]�f�����8�d��H���H�����H�=�R"I��H��VH���1������f����f��H� �R"�H�=#O�������c�������@��H�5��������S�H���H��dH�%(H�D$1�H�T$�P�H�{@�S0�����H�����u�L$H��H�5�H����H�L$dH3%(uH��[��R��f���SH��H��dH�%(H�D$1��o���uk�H�T$�H������S0H�{@��S��H����H�{@�H���*���t$H�����H�L$dH3%(u2H��[��H� 9Q"� �H�=HU�S������������AWI���`AVAUATUH��1�SH��8H���dH�%(H��$(1�H���H�H��L�����H�|$�������H�|$��1���H�|$�E��H�|$A�����E��H� �PH��H��P��%��I��H� �PH��P���H�|$pH��t;���L��P<w��H��!L��H� �P��H��P�p�H�|$(H��t%�!����H� �PI��H��n�A�H�|$0H��tq�r��� � H��$��H��L�VPH��R���RH��H��0H�� I��1���R��*��H�� I��H� 4PH�;P�����H�|$8H��tq���� � H��$��H��L��OH��R���RH��H��0H�� I��1���R����H�� I��H� �OH��O���K��Eu=H���m�H��$(dH34%(�?H��8[]A\A]A^A_��H��$�H��t*���<w!D����H� oOH��N�A�H�|$ H��t����E1�1�E1�H� ]O��H����H�5QO�L�-�N�i�L�%�eL�5zNH��u?�|@D��H���!L��M��MD�H��L��IEͿ1��@�A��H��t?H��H���H��t�A��v�A�G�L�N��w�H�5<�!L��M��MD���H�5NJ��G��������ff.�f���H��xI���dH�%(H�D$h1�H��H�bNH���H�H����H�T$L��H�D$H� FNH�DNH�D$H�D$(H��]H�D$0H�q���H�D$8H��GH�D$@H����H�L$ H�D$H�*�H�T$hdH3%(uH��x��0����H��8f�dH�%(H�D$(1�H��)$H�D$�G4)D$��u1�H�L$(dH3%(uH��8ÐH��H��L��������f.���SH��H�OH��SH�=L"�1��Z��H�K�1�H�=�K"H��S�<��H�K�1�H�=�K"H�KP���1�[�f.���H�5�� ����H�5�����ff.���S�H���H��dH�%(H�D$1�H�T$���S0H�{@��/��H�{@�S4����H�������u�L$H��H�5TH���\�H�L$dH3%(uH��[�������SH��H��dH�%(H�D$1������tKH�T$��H����H�{@�S0�����t$H���'�H�L$dH3%(u3H��[ÐH������H�=�J"�H� OH��1������������ff.�@��Sf�H��H��@dH�%(H�D$81�H�����)$H�D$H��RH�D$H��)D$ H�D$������uBH���2��H��H�Cx���H��H� JH���D�H�L$8dH3%(u0H��@[�fDH� �I"�#�H�=pQ�����������ff.�@��Sf�H��H��@dH�%(H�D$81�H�)���)$H�D$H��MH�D$H��)D$ H�D$�����uBH���b��H��H�������H��H�MIH���q�H�L$8dH3%(u-H��@[�H� �H"�!�H�=�P���������O��ff.�@��USH��H��dH�%(H�D$1��^������H������H�T$H�߾H����H�SxH�{@��"��H���H�{@�A� ��H�{@�3H������t$H����H�L$dH3%(u4H��[]�f�H� H"�"�H�=P�#�������g�����AWI���`AVAUATUH��1�S�����H��8H�r��dH�%(H��$(1�H���H�L��H������H�|$H����H�|$��H�|$�����H�|$A�����H�|$���z��1�I��� �E��1ɾH��G����M��H� �KH��G��u��A��H� �KH�<P���H�|$@H��tq���� � H��$��H��L�jGH��R���RH��H��0H�� I��1���R��>��H�� I��H� ;KH�FK�����H�|$HH��t%�����H� (KA��H�)K��H�|$PH��t%������H� �JA��H��J���H�|$XH��t&�m����H� �JD��H��J��H�|$`H��t;�=��L�5F<w��H�x�!L��H� �S��H��N��H�|$hH��t;���L��E<w��H���!L��H� aJ��H�cJ���H��$�H��tqH��$�tf�e��H��$�I������M��H� 1JH��I����s��EA�ؾH� �IH�zj�HD�H��I���Eu>H���a�H��$(dH34%(���*H��8[]A\A]A^A_�fDH�|$ H��t��1��E1�1�E1�H� �E��H�����H�5�E�L�-�D��L�%\L�5�DH��u>�{D��H���!L��M��MD�H��L��IEͿ1��p�A��H��t?H��H���H��t�A��v�A�G�L�GD��w�H�5��!L��M��MD���H�5~@��w�����f�H� �C"�'�H�=xA���������f���H��I���dH�%(H�D$x1�H��H�vHH�5l����H�H�r���H�T$H� ���H�D$H�QHH�=DDH�D$8H�D$HH��=H�L$H� "DH�T$ H�(HH�t$(H��H�|$@L��H�D$PH�����H�L$0H�D$X��H�T$xdH3%(uH�Ĉ��"��f���H��H�OH�=mB"1�H��J�����H� NB"�H�=�K����4H� 1B"�H�=�K�p���+H� B"�H�=L�S���FH� �A"�H�=L�6���.H� �A"�H�=FL����IH� �A"�H�=YL����+H� �A"�H�=�L�����FH� �A"�H�=�L�����%H� fA"�H�=�L����@H� IA"�H�=�L����%H� ,A"�H�=M�k���@H� A"�H�=M�N���&H� �@"�H�=6M�1���AH� �@"�H�=AM����&H� �@"�H�=lM����AH� �@"�H�=wM����1�H�����U�H��SH��dH�%(H��$�1�H��H���H�H�H��H�D$H��HH�D$H��H�D$H��HH�D$ H�UH�D$(H�yHH�D$0H��H�D$8H�dHH�D$@H��H�D$HH�OHH�D$PH�MH�D$XH�WIH�D$`H��H�D$hH�"HH�D$pH��H�D$x������t6H��?H��H�����H��$�dH3%(u1H�Ĩ[]��1�H����H��t�H�5�H������������S1�H�������t[�H��H�5�[�����SH�5t�!H���l����t[�fDH�������u�H��H�5�[�d�@��SH�54�!H���,����t[�fDH���X����u�H��H�5�[�$�@��SH�5��!H��������t[�fDH�������u�H��H�5*[���@��SH�5��!H�������t[�fDH��������u�H��H�5z[��@��SH�5t�!H���l����t[�fDH�������u�H��H�5�[�d�@��SH�54�!H���,����t[�fDH���X����u�H��1�H�58[����f���SH�5��!H��������t[�fDH�������u�H��1�H�5�[���f�SH��H��I��H������I��H� ;:[1Ҿ������AWI���`AVI��1�AUATUSH��L�%���dH�%(H��$1�H��L���H�L��H��� ��H�|$�����H���9H�|$�-H�|$x�!�P��H�|$L��$�����1�H���b�A��H� �<H��<��"�I�ؾH� �<H��<���L�l$xL�����H���s1�H��$L��L��`�H�H�������uzH��$�H��tmH��$�tb���H��$�H�����H��$�tH��H���h���H�����H��L�����L��H���J��H����H�H)�������a���L���)��H��$dH3%(uH��[]A\A]A^A_�����f.���AVA�ιAUI��ATA��UD��SH��H��dH�%(H�D$1�H�T$�B���S0H�{@������S4��uZH�{@��D�����A��tUH���m����u�L$H��L��H�����H�L$dH3%(u<H��[]A\A]A^�f.�H�{@��b����H�{@�(�K�M�������fD��ATI��U��SH��H��dH�%(H�D$1�H�T$�� tb��h���S0H�{@�����S4��ug��tuH�������u�L$H��L��H���-��H�L$dH3%(u_H��[]A\�@�� ����S0H�{@�����S4��t�H�{@��{�����u�H�{@�(�K�c����s���� ���f���H�U���� ���ff.���SH��H��dH�%(H�D$1�H�t$�J����t,�C`�L$�H��H��mA�Z������t�CuH�Cn�H�����H�L$dH3%(uH��[��[���ff.���SH��H��dH�%(H�D$1�H�t$�����t,�C`�L$�H��H��aA�@�4�����t�CuH�3b�H�����H�L$dH3%(uH��[��˾��ff.���SH��H��dH�%(H�D$1�H�t$�*����t,�C`�L$�H��H�� A�<�����t�CuH�� �H���f���H�L$dH3%(uH��[��;���ff.���UH��SH��dH�%(H�D$1��GH�t$��<ۃ�������t)�E`�L$A�>��H��H��������t�EuH����H������H�L$dH3%(uH��[]�螽��ff.���UH��SH��dH�%(H�D$1��GH�t$��<ۃ��������t)�E`�L$A�=��H�=H���e�����t�EuH�4��H���*���H�L$dH3%(uH��[]����ff.���SH��H��dH�%(H�D$1�H�t$�Z����t,�C`�L$�H��H�/A�?������t�CuH���H�����H�L$dH3%(uH��[��k���ff.���UH��SH��dH�%(H�D$1��GH�t$��<ۃ�������t)�E`�L$A���H��#H���5�����t�EuH��$��H�����H�L$dH3%(uH��[]��λ��ff.���@�� v@���H��5H��=HE���@��H� �!H������SH�� dH�%(H�D$1�H��tFH���H��tUH��H��LH��1���̻��I�ؾ�H� =H��W��H�D$dH3%(u8H�� [�fD�GX��u�I��L��<H��1����������Ϻ��ff.�@��SA��H��1�H��4���]�I�ؾ[H� +9H��4��l�ff.����AUf�I���ATM��A��U��1�SH��H�B4H��XdH�%(H�D$H1�)$)D$)D$ )D$0�U�1�I�ؾH�4����I�|$��A��1�H��<I�����H���@1�U�I��L��;�@L���ط��ZYA�EX��tH�D$HdH3%(uVH��X[]A\A]�M��1Ҿ�H� g;�U���I��I��L�K;1��@��@L���j�����3�����@�� v6@���L��:H�3LE�H� ;��H� ;���@��H�e�!L����ff.�@��H��tGUH��H��E1�S1�H���H����H��A��H��H� /[��]��f��ff.�@��H��t7S��H��H��A�ؾ���A��H� �6[1Ҿ��p��ff.�@��H��H��tH���,�@����H��hf�H��2dH�%(H�D$X1�H���)$H��H�D$H� o2H�D$H�D$(H�,H�T$ H��9H�D$0H�z�H�L$)D$@H�D$8�f��H�L$XdH3%(uH��h��l���f.�f�AWAVAUATUH��SH��xH��0H�t$�T$dH�%(H�D$h1������H���FH���H��E1�H��tH���7���H��0A���(���H��0H�5�9H���I����������H����D$H��t ����D$H���H�����ӻ��L�d$ �@L���A���<�H������LE�D��H�5�8H���h������H���D$H��tH���t���H���D$�T$H�5�8H���&����uBH����D$H��tH���6���H����D$�T$H�5d8H��������tt@�H�t$hdH34%(�7H��x[]A\A]A^A_��L���M��t$L��E1��I���H���I������f.�1�E1����fD1����H�T$�t$H�����H����T$H��H�5�7����H���D��H��H�5�;�U���H��0L��H��H�5�7���H����T$H��H�5�;�"���H���T$H��H�5^7�h���H���D��H��H�5/7�O���H��L��H���1���H���H������H���������苴��ff.���ATI���`UH��1�SH��H�����dH�%(H��$1�H��H���H�H��L������H�|$tNH�|$H��tD�Ϸ��H�|$I���B���H��L��H������H��$dH3%(uH��[]A\���������Գ��@��AWI���`AVI��1�AUATUSH��(H���dH�%(H��$1�H�|$�H�H�L$L���O���H�|$��H�|$ H����H��$�������H�|$L��$I���l���L��$��D$L��舷��H���N1��`L��H�5O���H��$�H�H���|�����uO�T$L��L��L�������u8H��訴��H��L���-���L��H�����H����H�H)�葸����u��H��$dH3%(uH��([]A\A]A^A_ø�������w����AWAVAUATUSH��H�t$�T$(dH�%(H�D$x1�H��h������hH��H��PH��E1�H��t�I���A��H��XE1�H��t�2���A��H��`E1�H��t����I��H��h����H��hH�5�4H���I���������H���H��� �Զ��H�L$0�@H�Ή�H�L$�D$�7�H�L$���HD�H���H�D$ �T$H�5�3H���X������H����D$H��tH���d���H����D$�T$H�54H�������uBH����D$,H��tH���&���H����D$,�T$,H�5T3H��������tt@�H�T$xdH3%(�]H�Ĉ[]A\A]A^A_�DH���H�|$ H��t�:���H����D$H�D$ �����1��D$����1��H�T$�t$(H�����H����T$H��H�533���H��PD��H��H�5�6�E���H��XD��H��H�5�6�,���H��`L��H��H�5�6����H��hL��H��H�5�2���H����T$,H��H�5)2�@���H����T$H��H�52�&���H�t$ H��H����H���H�����H��H������H����������U���D��AUI���`ATUSH��1�H��H�k���dH�%(H��$1�H��H���H�H��L���Ԯ��H�|$��H�|$H��t~虲��H�|$I������A��CtsH��$�tX1��!�L��D��H�����H��H���(��H������H��$dH3%(u:H��[]A\A]�f.��������f�H���L��H�������I���f���AWI���`AVAUATI��1�USH��(H�W���dH�%(H��$1�H�|$�H�H�L$L��迭��H�|$�;H�|$ H���-H��$P��q���H�|$L��$I���ܲ��L��$P�D$L�����H��L�����L��H��袳��H����H�H)��Q�������1��`L��H�5����H��$�H�H���ű����upA�D$tHH��$���1�肽�t$L��L���S�L��L�����L��� ��H���Ȯ��H���[����T$L��L��L���n�����t�f�H��$dH3%(u$H��([]A\A]A^A_�������ѐ���蔬��@AWAVAUATUSH��H��xH��(dH�%(H�D$h1������H����H��0I����I��A���n���I��0�D$�^���I��0H�5/H�߉�H����������I��8H��2E1�H��t5H���ݱ��I��8H��%D��A��wA��H���!H��fDH�5�.H���!������)I���H���A�İ��H�L$ �@H�Ή�H�L$�D$�'�H�L$���HD�I���H�D$�T$H�5�-H���H�������I����D$H��tH���T���I����D$�T$H�5�-H���������~I���D$H��tH������I���D$�T$H�5M-H���Ļ�����<1���L��D��H�����I����T$H��H�5 -��I��(�T$H��H�501��I��0H��H��H�5J-�:�I��8t5L�8$A��wH��!N��H� �0��H�-��I���H��t*���<w!D����H� s$H��#�E�I���T$H�5T,H���[�I����T$H��H�5!,�A�H�t$L��H���!�I���H�����H�����f.��H�\$hdH3%(uZH��x[]A\A]A^A_�@I���H�|$H��t'��I����D$H�D$����f�1��D$�������ff.����AUI���`ATUSH��1�H��H����dH�%(H��$1�H��H���H�H��L��脨��H�|$��H�|$H��t~�I���H�|$I��輭��A��CtsH��$�tX1��ѸL��D��H����H��H������H���p���H��$dH3%(u:H��[]A\A]�f.��������f�H���L��H���p�������f���AWI���`AVAUATI��1�USH��(H����dH�%(H��$1�H�|$�H�H�L$L���o���H�|$�;H�|$ H���-H��$(��!���H�|$L��$I��茬��L��$(�D$L��訫��H��L��蝫��L��H���R���H����H�H)���������1��`L��H�5H���H��$�H�H���u�����upA�D$tHH��$���1��2��t$L��L����L��L���8��L������H���x���H���[����T$L��L��L�������t�f�H��$dH3%(u$H��([]A\A]A^A_�������ѐ����D���@ATI��UH��S葪��H���f��t5f�� uJH�s�.H�� ����H��t/�C[]f��fA�$1�A\�H�s�.H�����H��u�[���]A\�ff.�AUI��4L��,ATI��UH���4S�ںH��HdH�%(H�D$81�I��H��SL��褣��XM��ZL��L����J�1�I��H� 2,��/�1�A�ؾH� �#��d�H�D$8dH3%(uH��H[]A\A]�����@AWI��AVAUATUH��SH��H��H�y�T$dH�%(H��$�1�H��t �����E1�H���E1�H��tH���ϩ��H���A��D��H�5'H��胵������L���M����L���S���L����D$+����L��H�5X&H��H��諶����ugH���[���H��H�+A��=t+��H��*=t=?H��*H��*HE�H�5�H���I�����tuDH��$�dH34%(��.H��[]A\A]A^A_�f�D�u4D9�u�����f�1��D$+�/���@��H�d*H�k*HE��f�H����D���H�5<H���H�t$< w��H�3�!H��H�D$H�T$H�5�%H��膵�����>���H��H����H�D$PH�T$LH��H��H�D$���������H��H�T$H�5�%H���1��������H���T$LH�5o%H��螳��������H��H����H��$�H�T$NH��H��H�D$ �)����������H��H�T$ H�5 %H��趴�����n���H���T$NH�5%H���#������K���H���H���,�6���H��$��@H�Ή�H�L$0�D$,��H�L$0���HD�H���H�D$8�T$,H�5*$H��跲��������H����D$0H��tH���æ��H����D$0�T$0H�5a$H���u����������1��Ʊ�t$I��D��L��H�����H����T$0H��H�5 $���H���D��H��H�5�#��H���t �t$+H�����L�D$��H� �(H��#�ոL��'A��t/�L��'A��tA��?L��'H��'LE�H� �'��H�7�y�H����T$,H��H�5�"��H�t$8H��H�����H��t�T$LH�t$H�=#����H��t�T$NH�t$ H�=�"�_���H���H���0���H���(����3���H�D$PH�D$����H��$�H�D$ ���H���H�|$8H��t9�y���H����D$,H�D$8���A��L��&H��&LE����1��D$,���聟�����ATI���`UH��1�SH��H�����dH�%(H��$1�H��H���H�H��L������H�|$tfH�|$H��t\�Ϣ��H�|$I���B���H��$�t?H��$t4H�ى�L��H�����H��$dH3%(uH��[]A\�D�������輞��ff.����AWI���`AVI��1�AUATUSH��(H�Ǫ��dH�%(H��$1�H�|$�H�H�L$L���/���H�|$��H�|$ H����H��$�����H�|$L��$I���L���L��$�D$L���h���H��L���]���L��H������H����H�H)��������1��`L��H�5���H��$�H�H���5�����uEH��$�t5H��$t*�T$L��L��L�������uH���K���H���n��������H��$dH3%(uH��([]A\A]A^A_�fD����4���@AWI��AVE1�AUATI��U��SH��H��H�ydH�%(H�D$x1�H��t�#���A��D9s4t2H�t$xdH34%(��kH�Ĉ[]A\A]A^A_��I����ܡ��I���H�5H�߉�A��葭����u�I����D$H��tH��衡��I����D$�T$H�5�H���S������a���I����D$H��tH���_���I����D$�T$H�5�H������������I����D$H��tH������I����D$�T$H�5iH���Ϭ��������I������I���H�58H�߉D$蟬���������I���H�#�D$H��t/H���g���I���H�X�D$<w��H���!H��H�5�H��豭�����O���I�������I�������H�L$�D$ �S��H�L$H�5H��H���l������ ���I����ؠ��H��I���H�T$<w��H�'�!H��H�D$H�T$H�5TH�������������I���H����轟��H�L$0�@H�Ή�H�L$(�D$$� �H�L$(���HD�I���H�D$(�T$$H�5�H���A������O���1�蒪M��D��L���H�����I���D��H��H�5���I���t"D�D$��H� f!H�e���|$ �����H� �I��H��衱L�D$�H� =!H�;���I���t"D�D$��H� � H��裭I����T$H�5�H�����I���t;�|$L�"w�D$H���!L��H� � ��H����I����T$H��H�5c�z�I����T$$H��H�5@�`�H�t$(L��H���@��I���H���ѷ��H���ɶ�����I���H�|$(H��t�>���I����D$$H�D$(�!���1��D$$�����a������AUI���`ATUSH��1�H��H�{���dH�%(H��$1�H��H���H�H��L�����H�|$��H�|$H����襛��H�|$I������A��Ct_H��$�t|1��-��K4I��L��D��H���I��H��H���.���H���Ƶ���H��$dH3%(u[H��[]A\A]�H��$�tH��$�tH��$�u������밐H��$�t�H���L��H��������.���ff.���AWI���`AVAUATI��1�USH��(L�=7���dH�%(H��$1�H�|$L���H�H�L$L��蜖��H�|$�H�|$ H����H��$����N���H�|$L��$H�$踛��L��$��D$L���Ԛ��H��L���ɚ��L��H���~���H����H�H)��-������1�H��$L��L���`�H�H��襚����ueA�D$��H��$�tI1��b�A�L$4M��L��H�$�t$�z��L��L���_���L�����H��蟗��H���V���������H��$dH3%(urH��([]A\A]A^A_�fDH��$�t�H��$�t�H��$�t�H��$�t��T$H�4$L��L���!������q����fD��{����1������H��Xf�H� v dH�%(H�D$H1�H�&)$H��H�D$H��H�D$H��H�D$ H��)D$0H�L$H�D$(觫��H�T$HdH3%(uH��X�譔��ff.�f���H��Hf�H� ndH�%(H�D$81�H�*H��)$H��)D$ H�D$H�L$H�D$�/���H�T$8dH3%(uH��H��5���D��SH��H�OH�-H�=v "�1��ʙ��H�K�1�H�=X "H�)謙��1�[����H��H�OH�=- "1�H�4��z����4H� "�H�=:�M���1�H���fD��S�H���H��dH�%(H�D$1�H�T$����H���h�����u�L$H��H�5&H�����H�L$dH3%(uH��[��#�����H��I���`1�dH�%(H��$1�H��H�.����H�L��H��谒��H��$H��t-辘��L��<v{H� ���H��薪H��$�E1�H��t聘��E1���A���H� M�H�R�˫�H��$dH34%(uH�����H���!L���r����0�����USH��H��dH�%(H�D$1��N�����u@H��H�-�諞��� H�=�H�������tPH�ƹH�������t:H� C"�*�H�=��]������H�\$dH3%(ucH��[]ÐH���8���H��H�T$H���H�߾@��@������@��H�{@1҅�B���#����t$H���'�����0�����H��hf�H� �dH�%(H�D$X1�H�f���)$H��H�D$H��H�D$H�*H�D$ H�����H�D$(H�(H�D$0H�����)D$@H�L$H�D$8菧��H�T$XdH3%(uH��h�蕐��D��H��XH� /H�ZdH�%(H�D$H1�f�H�� H��H�L$H� �H�T$H�� )$)D$0H�D$H�L$ H�D$(����H�T$HdH3%(uH��X�� ���ff.�f���H��XH� s.H��dH�%(H�D$H1�f�H�o H��H�L$H� H�T$H�h )$)D$0H�D$H�L$ H�D$(�w���H�T$HdH3%(uH��X��}���ff.�f���H��xI���dH�%(H�D$h1�H��H��-H���H�H�yH�T$L��H�D$H� � H��H�D$H�D$(H�H�D$0H�AH�D$8H�NH�D$@H��H�L$ H�D$H躥��H�T$hdH3%(uH��x������H��Xf�H� /-dH�%(H�D$H1�H��)$H��H�D$H�7H�D$H��H�D$ H�)D$0H�L$H�D$(�7���H�T$HdH3%(uH��X��=���ff.�f���H��I���dH�%(H��$�1�H��H��H���H�H��H�T$L��H�D$H� �H��H�D$H�D$(H��H�D$0H��H�D$8H��H�D$@H��H�D$HH��H�D$PH��H�D$XH��H�D$`H�SH�D$hH��H�D$pH��H�L$ H�D$x�,���H��$�dH3%(uH�Ĩ��,���ff.����H��XH� �+H�jdH�%(H�D$H1�f�H��H��H�L$H� 9H�T$H��)$)D$0H�D$H�L$ H�D$(藣��H�T$HdH3%(uH��X�蝌��ff.�f���H��XH� +H��dH�%(H�D$H1�f�H��H��H�L$H� �H�T$H��)$)D$0H�D$H�L$ H�D$(����H�T$HdH3%(uH��X�� ���ff.�f���H��XH� s*H��dH�%(H�D$H1�f�H�oH��H�L$H� H�T$H�h)$)D$0H�D$H�L$ H�D$(�w���H�T$HdH3%(uH��X��}���ff.�f���H��Hf�dH�%(H�D$81�H��)$H�D$H�NH�D$H��H�D$�G4)D$ ��u 1�H�L$8dH3%(uH��H�f�H��H���ѡ�������f.���H��Xf�H� O)dH�%(H�D$H1�H�v)$H��H�D$H�WH�D$H��H�D$ H�+)D$0H�L$H�D$(�W���H�T$HdH3%(uH��X��]���ff.�f���H��Xf�H� �(dH�%(H�D$H1�H�)$H��H�D$H��H�D$H�`�H�D$ H��)D$0H�L$H�D$(�Ǡ��H�T$HdH3%(uH��X��͉��ff.�f���H��hf�H� /(dH�%(H�D$X1�H��)$H��H�D$H�7H�D$H�JH�D$ H�KH�D$(H���H�D$0H��)D$@H�L$H�D$8����H�T$XdH3%(uH��h��%���D���H�5��ۣ��ff.����H�50黣��ff.���1�H�5�鞣��ff.���1�H�5��~���ff.����H�5p�[���ff.����H�5��;���ff.���1�H�5������ff.���1�H�5����ff.���1�H�5#�ޢ��ff.���1�H�5S 龢��ff.�AT�A��U��SH��H��dH�%(H�D$1�H�T$�\���H�{@��J���H�{@��K�և���S0H�{@��Ň���S4H�{@�贇��H�{@D��O裇��H�{@��蓇���t$H���'���H�L$dH3%(u H��[]A\�����f�U����SH��H��dH�%(H�D$1�H�T$葞���S0H�{@�� ����S4H�{@�����H�{@��K���H�{@��J���H�{@��L�ن���t$H���m���H�L$dH3%(uH��[]��a������SH��H�OH��H�=��!�1����H�K�1�H�=��!H���܋��H�K�1�H�=j�!H��辋��H�K�1�H�=L�!H��蠋��H�K�1�H�=.�!H�肋��H�K�1�H�=�!H�A�d���H�K�1�H�=�!H���F���H�K�1�H�=�!H���(���H�K�1�H�=��!H��� ���H�K�1�H�=��!H�����H�K�1�H�=z�!H���Ί��H�K�1�H�=\�!H��谊��H�K�1�H�=>�!H�蒊���H� &�!�H�=� �e����H� �!�H�=� �H����'H� �!�H�=�+����,H� �!�H�=����� H� ��!�H�=� ��H�K�1�H�=��!H�� ���H�K�1�H�=q�!H���ʼn��H�K�1�H�=S�!H�{ 觉��H�K�1�H�=5�!H��艉��H�K�1�H�=�!H���k���H�K�1�H�=��!H��M���H�K�1�H�=�!H�,�/���H�K�1�H�=��!H�F����H�K�1�H�=��!H�h��H�K�1�H�=��!H���Ո��H�K�1�H�=c�!H�跈��H�K�1�H�=E�!H��虈��H�K�1�H�='�!H�l�{���H�K�1�H�= �!H�r�]���H�K�1�H�=�!H�|�?���H�K�1�H�=�!H���!���H�K�1�H�=��!H������H�K�1�H�=��!H�����1�[Ð��AWI���`AVI��1�AUATUSH��H�7���dH�%(H��$1�H���H�L��H��裁��H��$xH�������L��$�A��M����L��L��$���H���_@1��`L��H�5����H��$�H�H���������H��$�H��t~聆��D��L�����d�����upH������H��L��荅��L��H���B���H����H�H)������y����H��$dH3%(u(H��[]A\A]A^A_������͐��������Ā��@SH��H�����Z����S0H�{@����H�{@�S4����H��[鏘��ff.�@AWI���`AVAUATUSH��8L�%����H�t$H�|$ 1��T$L��dH�%(H��$(1��H�H�L$ L������H�|$(��H�|$0H���wH�|$8�kH��$��\萃��H�|$8A�L��$ H�D$��H��$��D$����H���DH���p���H��H��$���H��$�H��蠅��H����H�H)��O�������1�H��$ L��L��`�H�H���ǃ�����NH��$��?H��$H���v���� ���H��$�A��蹂��H��E��u�|$�N���E����1��F�L�D$�H� �H���贖D�D$�H� $�H�y����|$��H�5V��V�E1�1Ҿ�H� ���[�H�D$�H\��t�PX����I��H� �1�E1����&�����E1�1Ҿ�H� �����H�5���ώ�t���f.����H��$(dH3%(uVH��8[]A\A]A^A_�fDH�������_���1�E��u�1���D$��H�|$诛���D$랸������}}��ff.�f������f���1����D��SH��H��dH�%(H�D$1�H�t$躊����t,�C`�L$�H��H��A�>�4�����t�CuH���H�����H�L$dH3%(uH��[���|��ff.���SH���W4dH�%(H�D$1���u H�T$dH3%(u9H��[�f.�H�t$H�������uϋL$H��H�5� H��� �����R|��f���SH���W4dH�%(H�D$1���u H�T$dH3%(u9H��[�f.�H�t$H���C�����uϋL$H��H�5����H��虔�����{��f���SH���W4dH�%(H�D$1���u H�T$dH3%(u9H��[�f.�H�t$H��������uϋL$H��H�5!���H���)�����r{��f���SH���W4dH�%(H�D$1���u H�L$dH3%(��H��[�fDH���H�T$��ɒ���S0H�{@��X{���S4H�{@��G{��H�{@��J�4{��H�{@��K�!{��H���ْ�����q����L$H��H�5SH���[����V����z�����SH���W4dH�%(H�D$1���u H�L$dH3%(umH��[�f.�H���H�T$�����S0H�{@��z��H�{@�S4��wz��H���/�����u��L$H��H�5�H��赒����y��ff.���SH���W4dH�%(H�D$1���u H�L$dH3%(��H��[�fDH�5��!H��聇����uH�T$�H���6����S0H�{@���y���S4H�{@��y��H�{@��K�y��H���Y������q����L$H��H�5#H���ۑ���V����!y�����SH�54�!H�������t[�fDH��������u�H��H�5����[���@UH��SH��H��dH�%(H�D$1��o���H��H��脅����uPH���ȅ��H������uLH���D���H�� H���{��H�߉�蚅��H�L$dH3%(��u<H��[]Ð�����f�H�=��!H��1�H�( �����}����'x�����UH��AVAUA� ATI���SH��dH�%(H�E�1��|��H=���I�EH��H��H%�H)�H���H��H9�tH��H��$�H9�u���_L���ׄ������H�5h�!L���`����Å���H�5QL������Å���L���������H�UԾL�����A�T$0I�|$@��sw��A�T$4I�|$@��_w��I�|$@��K�Kw��I�|$@�ھO�:w��L�����Å�u\I�|$8��y��I�|$8L��H��A���_{�������U�Hc�M��L���D��H���<y��I�|$8A���?{��A��AE��H�u�dH34%(����H�e�[A\A]A^]�fD��^{��I���g���fDH)�H�L����f�H�5��L���A�����y ���f��މ�L���$����}���L�������k�����u��fD��SH��H�� dH�%(H�D$1�������H�5��!H��舃����t$H�L$dH3%(��H�� [�f.�H�5��H�������xɹH�T$�H�߉D$����H�{@��J�u��H�{@��K�|u���S0H�{@��ku���S4H�{@��Zu���D$H�{@����Fu��H��莁����t'H�5�H��������/���H�{@�¾O�u���t$H��觎������f�H���H��������t��f���AWAVAUATUSH��H��dH�%(H�D$1��������#H������H�5m�H������H�߅��,���H����I��H�5��H��L���yu��I��H����E1�L�5�!1�H�5���I��I�6��H����L����u����u�Hc�H���!L��1�H��H�5��Dd(� u��I��H��u�E��teH��踀��H���0�����tQH���4���H�5��H���E���H�߅�uv艀��D��H���N��&@L��H�5�H�=��!�1��x�����H�L$dH3%(u?H��[]A\A]A^A_���+���1�H�����������H��H�����r��f�AVAUA��ATUH��SH���z��H�5��H���������H��A������H��������tA��t���~[D��]A\A]A^�f�H���(��H���px��H�H�ËH����������!ʁ ��t��H�����D�H�KHDى�@�H��H)�A���E����tE��uE�����u����H��A������o���DH��A����~��H�=c�!�H��H��1��w���:������AWI���`AVAUI��1�ATUSH��HL�%�}��dH�%(H��$81�H�|$0L���H�H�L$0L���<q��H��$��L���~������1�H�t$(L���^�����t*H��$8dH3%(��H��H[]A\A]A^A_Ð�H�T$$�L��詈��A�U0I�}@��7q��A�U4I�}@��%q��I�}@�P��s��H�|$(H�5��H�D$�u��H�D$H���&L��$0H��$���t���D$H���@H���Hr��H��H��$���t��H��$�H���xv��H����H�H)��'v���Ä���1�H��$0L��L��`�H�H���t����uhH��$�L��$ H��tSM��tNH��$(�o����s��H�|$H����q�����U���L���t��I�}@�^��� p���\$�4���@����l���fD�|$t�H�5[�1��t��H�D$H�����I�}@H�t$�s���t$$L���S����$���L���������������������=o��ff.�f���SH��H�� dH�%(H�D$1��O|������H�t$�H��������u_�H�T$�H��芆���S0H�{@��o���S4H�{@��o��H�{@�P��q��H�{@H���.s���t$H��肈��H�L$dH3%(uH�� [�@H����������dn��@��AWI���`AVAUI��1�ATUSH��H�wz��dH�%(H��$�1�H�|$L�d$H��$ �H��H���H�L��L����m��H�|$H���H�|$ ��H�|$(���r��H�|$(�$��r��H�|$ A���dq��H��$`I��H��t��r������H�qp auto DŽ$(offH��$ 1���}�4$M��D��L��L�����I�ؾH� q�H�M���.�L���V����H��$�dH3%(��H�ĸ[]A\A]A^A_��H� y�!�'�H�=X��r��������@H��$p�D$H��t���q��1�H�߉D$H�辀H�qp auto�H�H��$H��1�H��$H���m���D$����H�-K�!��D$H�=l�D�D$�3H�5��H���Aj��H�u��H���0j��1�H��H�}H��tqD�ED�D$t�T$��k���t$�D�D$�������T$�Һ�u�H�5��H����i���f���H�5�H���i���>����Hcl$H��H���$�����H�5��H���i�������k��ff.�@��AWAVA��AUI��H��ATI��USH��(dH�%(H��$1�L�|$�o��H���&DH��$�H��H��L����H����l��H��L���_o��L��H���q��H����H�H)���p������1�H�|$�`L���H�H�5w��H���:o����ueH��$�H��tXH��$�tME��t��Cn��H��$�H���j��A�M\���O���A�UX���C���L��H�D$讈��H�D$�,���@���H��$dH3%(uH��([]A\A]A^A_�fD����j��@��AWI���`AVI��1�AUATUSH�� H�'v��dH�%(H��$� 1�H�|$`�H�H�L$`L���i��H�|$h�CH�|$pH���5H��$��&�Am��H�|$hH�D$P�n���D$\H��$�H��H�D$��m��I��H��$`H�D$H��$`H�D$HH��$` H�D$@�H�l$H���m��H��H���@o��L����H�L)���n��A�ń���1��`H��$`H�T$�H�H�5&u��L���^m������H��$x�D$H��t ��m���D$H��$�L��$�H�D$ H���)M��� H��$�H����m��H��$�H�5M�L���D$,�]y������H��$0H����H���,n��H��$0���D$4���f���H��H�5.�L��H���z�����yH��$@H�����#m��H�\$@�@�ljD$0H��苓H��$@���HD�H�D$8�T$0H�5#�L���x�����L���l��D�l$[L�l$HH���p�1��`L��H�5�s��H��$`�H�H����k�����H��$H�����}l��H��$H�5��L�����4x������H����h��H��L���yk��L��H���.m��H����H�H)���l�����e���H�t$ 1�L��D�l$[�p�������H��$� dH3%(�jH�ĸ []A\A]A^A_ÿH�5��L�|$��wL��谄��L���Xh��I���H���1��D$4�F����H��$HH�|$8H��t&� j��H��$@�D$0H�D$8�|����1��D$0�f���f���?���fD1��iv�L$�t$\L��L�D$H�T$P����D�D$,�H� �H����� zH��$0t�t$4L��膬��H��$@�T$0H�5�L���{���H�T$H�t$8L��� ���H�t$ �L������H�5����6vE1�1ҾH� ����;}L���i��L�|$L�|$HH���-@A��H� P�1�E1���RyH����f��H��L���_i��L��H���k��H����H�H)���j�����-���1��`L��H�5 q��H��$`�H�H���7i����uRH��$H��tE��i����E���e���E1�1Ҿ�H� H��j|�E���D��������fD��������Qd�����ATI���`USH��1�H��H�mp��dH�%(H��$1�H���H�H��L����c��H�|$��H�|$H����H�|$��H��$����g��H�|$I����h��1����tM��H� ��H�����{A��H� ��H�P���wH��$�H�ߺ��H�߉��z���H��$dH3%(��uH��[]A\�f���������$c��@��H��I���dH�%(H��$�1�H��H���H���H�H�#��H�T$L��H�D$H� ��H��H�D$H�D$(H��H�D$0H�K��H�D$8H�f�H�D$@H�c��H�D$HH�Z�H�D$PH�[�H�D$XH�t�H�D$`H����H�D$hH���H�D$pH�K��H�D$xH���H��$�H����H�L$ H��$��x��H��$�dH3%(uH�ĸ��a��f.�@AVI��AUA��ATE1�UH��SH���H��H��tH���f��H���A��D��H�5��H���r�����t[��]A\A]A^�D1���qL��D��H��軦��H���D��H��H�5g���H���H��t�H��������u�H���Z���[]��A\A]A^�f.���ATI���`UH��1�SH��H�=m��dH�%(H��$1�H��H���H�H��L���`��H�|$tNH�|$H��tD�od��H�|$I����e��H��L��H������H��$dH3%(uH��[]A\���������t`��@��AWI���`AVI��1�AUATUSH��(H��l��dH�%(H��$1�H�|$�H�H�L$L����_��H�|$��H�|$ H����H��$P���c��H�|$L��$I���e��L��$P�D$L���(d��H���N1��`L��H�5�k��H��$�H�H���d����uO�T$L��L��L�������u8H���Ha��H��L����c��L��H���e��H����H�H)��1e����u��H��$dH3%(uH��([]A\A]A^A_ø�������_���AWAVAUATUSH��h�T$dH�%(H�D$X1�H�������� H��H���I��H��H�����c��L�d$�@L���A���V�H������LE�D��H�5��H���o������H��E1�H��tH���c��H��A��D��H�5��H���Go����um1��n�t$L��H���m���H��D��H��H�5��褥��H���D��H��H�5k�若��H��L��H���m���H���H���|��H���{���H�T$XdH3%(uKH��h[]A\A]A^A_�f�L���M��t$L��E1��Ia��H���I�����f.�1�E1�����q]�����ATI���`UH��1�SH��H��i��dH�%(H��$1�H��H���H�H��L���\��H�|$tNH�|$H��tD�`��H�|$I���2b��H��L��H������H��$dH3%(uH��[]A\����������\��@��AWI���`AVI��1�AUATUSH��(H��h��dH�%(H��$1�H�|$�H�H�L$L���?\��H�|$��H�|$ H����H��$�����_��H�|$L��$I���\a��L��$��D$L���x`��H���N1��`L��H�5?h��H��$�H�H���l`����uO�T$L��L��L��������u8H���]��H��L���`��L��H����a��H����H�H)��a����u��H��$dH3%(uH��([]A\A]A^A_ø�������g[���UH��AWI��AVL������AUL��ATSH�˹ H���H��@�����<���dH�%(H�E�1�H����H�������"H���H���5� `��L�������@L��lj�l���脆H������LE�L��H�����l���H�5�L���k������H���Džh���H��tH���_��H�����h�����h���H�5��L���^k�����nH���H�b�ƅ;���H��t4H���$`��H���H����;���<w��H�2�!H��fDH�5�L���il����� H���Dž4���H��tH���_��H�����4�����4���H�5-�L���j������H���Dž0���H��tH���^��H�����0�����0���H�5��L���ij����u}H���f�)�p���H��(���H��t_H��(����[_��f����M�ohI�GhL9���L�%��H��`�����M�mL;�`�����I�}L����e����u���H�]�dH3%(��H�e�[A\A]A^A_]ÐH���H��H���H��t%�X\��H���Džl���H��H�������Džl���1����������L��P���H�������1��hH��@�����<���L��耝��H�����h���L��H�5��负����;���L���H� ���H� ���o��������H�5[���hE1�1ҾH� ���oH�5|�L���\��I��H��tSM��1Ҿ�H� ���uoH�5G�1��w\��I��H��tE1�1Ҿ�H� "��Do�f���E1�1�H� ���%o1���yhH�����4���L��H�5��蝞��H���L����0���H�5n�聞��H���L����l���H�5E��e���H��H���H��L���C���H���L����u��L����t������H��(�����Z��H�5��L��P���H��`���H��p���I��H�� ���H�������f��[��H�����H��P���H�5����A���<g������H���H��p���L��`���AU��H��L�'��2T��L�� H����������!�%����t�L�������D�H�JHDѹ��@�L��H��H��H)�H����}[��H�o�_AXH��`���L���dW��I��L��(���L����Y��L��H���[��L����H�L)��F[�������1�H��p����`H�� ����H�H�5a��L���Y������H�����H�������H��H���H����H��P������+Z��H��P������Z��f�)�����9��>���H������L�����E1�E1�A��H��X�����E���E����H��L��`���L���AUH��X�����1���R��H��X���YL��^H�Ƌ H����������!�%����t�I������D�H�JHDѹ��@Ǹ�L��H��L)�H)�H����Y��L��L�� H����������!�%����t�H��X��������D�H�JHDѹ��@�H��H��E1�E1�H)�1��1Y��H�s�H��`�����A9�r8H��H���H��P�����H�5��d��������E����A�݃�A9�s�L�����E�������H������E����H��L��`���L�Q�AU��H��1���FQ��XZL�� H����������!�%����t�L�������D�H�JHDѹ��@�L��H��H��H)�H����X��H���H��`�������@A�����ATL��`���L���AU���f�ATL��`���L���AU�:���f�L�� H����������!�%����t�L�������D�H�JHDѹ���H��1�L)��W����*�����;���H��!L�������Q�����ATI���`UH��1�SH��H� ^��dH�%(H��$1�H��H���H�H��L���vQ��H�|$tNH�|$H��tD�?U��H�|$I���V��H��L��H�������H��$dH3%(uH��[]A\���������DQ��@��AWI���`AVI��1�AUATUSH��(H�W]��dH�%(H��$1�H�|$�H�H�L$L���P��H�|$��H�|$ H����H��$����qT��H�|$L��$I����U��L��$��D$L���T��H���N1��`L��H�5�\��H��$�H�H����T����uO�T$L��L��L�����u8H���R��H��L���T��L��H���RV��H����H�H)��V����u��H��$dH3%(uH��([]A\A]A^A_ø��������O����Gf��t>f�� u0D�G�E��u�w��u �O��tffD��tJ��f�����W���u��f���������� �����E�f��D�� f��f��W��u���USH��H���t:��/t&H���U��H��H��H�]��t��/t�DX t�H�������[]�H��1�[]�ff.�@��AVI����L���AUI�պATI��USH���dH�%(H��$�1�H�l$`H��VH�タ�L��ZY����~�#H�5L�H����P��I��H���XH�\$H�¾PH����O��H���s� H���N��H��t�L����M��1�H�t$H���P��I��H�D$�8��H9���H��������L�H���w1M�e1�H��$�dH3%(�,H���[]A\A]A^�@�sL���8"uſ"�S��L�-��!H��H���I���1�I�}�@S��I�}H��H���1���&S��������y���@H�a�!�&�H�=h�H���R��������K���L�-7�!I��H��1�H����I�}��R�����K���8�S��H��H�2�I��H��!H�81��R����������L�-،!I��L��H���I�}�mR��L���UL��� ����L��ff.����G�<v%�G�<v�G�< w'@���G���@���G��@���G���������f.���USH��dH�%(H�D$1�H���}�>H��tuH��H��H���N��H�$H��H��t[H9�tV�:uQH��������H¸����H���vH�|$dH3<%(u0H��[]�f��������H�H9�w�M1�����������K��@��ω������!�u!��tf.����u���1�ø��������USH��dH�%(H�D$1�H��tY�>H��tQH��H��H���{P�������H9�H�$��H9�t/H��t*�:u%��u!�E1�H�L$dH3%(uH��[]�D���������J��ff.����AVI��AUI��ATI��.UL��SH�� dH�%(H�D$1��J��H�t$H���<L����I��f��f/��H�l$H���L9���f.���5�/�D$��H���D$�8"��A��}������KH�5c�A�H���D$�H���D$���1H�5P�H���bH���D$���H�58�H���EH���D$����H�5w�H���D$�"H���D$����H�5��H���H���D$��tpH�5��H����G���D$��tWf�������lf�1�L���N��H�l$H��L9�t�H��t�H���t~H����f��H*�A��}���H,�f�ɉЉ��H*�f/�w#A�U1�H�\$dH3%(ujH�� []A\A]A^Ã�1�A�M��D�YX��fD�[G���8"�B���H��f�A�H��H }�H*��X��]����h����^H��ff.���ATUSH��dH�%(H�D$1�H��tg�>H��t_I��H��H���I��H��H�$H9�tEH��t@�8u;H���t%I�,$1�H�L$dH3%(u&H��[]A\�fD�F���8"u�fD��������G��ff.�����W������1����D��USH��dH�%(H�D$1�H��tY�>H��tQH��H��H���L��H�$H=����H9�t1H��t,�:u'��u#f�E1�H�L$dH3%(uH��[]�fD��������G��ff.����USH��dH�%(H�D$1�H��tY�>H��tQH��H��H���+L��H�$H=���H9�t1H��t,�:u'��u#�E1�H�L$dH3%(uH��[]����������|F��ff.����AUA��ATUH��SH��H��dH�%(H�D$1��E���H��ti�;tdD��H��H��I���CH��H�$H9�tJH��tE�:u@H��������H�H���w%H�E1�H�L$dH3%(uH��[]A\A]�@A�<$"uԐ���������E��@��ATA��UH��SH��H��dH�%(H�D$1��VD���H��t{�;tvD��H��H���H��H�$H��H��t\H9�tW�:uRH��������H¸����H���vH�|$dH3<%(u1H��[]A\Ð�������H�H9�w�M1�����������E��@��SH��H��dH�%(H�D$1�H�������uH�$��H�� ��H�� ��H �H�H�\$dH3%(uH��[��D����SH��H��dH�%(H�D$1�H�|$������u�T$ʉH�L$dH3%(uH��[��SD����SH��H��dH�%(H�D$1�H�|$�����u�T$f��f�H�L$dH3%(uH��[��C��ff.�@��AUI��ATI��US1�H��(dH�%(H�D$1�H�l$�H��L���I��H=��w=H�T$L9�t3f��f�D\���tC<:������H���uL�j�f.������H�t$dH34%(uH��([]A\A]�H�D$I�$����;C��ff.������� t���t1��������ff.����AUATL�gUH��SH��H��H��(dH�%(H�D$1�H�HLJL��H��H)������H��H�=!������u^����f�S���Q�����������Pf�{I�f���f�SH���}�1�H�t$dH34%(��H��([]A\A]�@�H�=��H�������tf�H�=��H�������tL�����:H��T$�ZB���T$H��ta� f�K��t4�� t/�������c���fD��t�f�S�C���>���L��H�� �`D����~��C�������������f�Cu�E1�L�l$1�L��H���F��H=�w�H�T$H9��v���B�D#���tS<.��A����I����R���H�j�@H��L����M���0����f�C��f�sf�C�z����C���n�����H��f�SL���o������C�C��u8��DH��H��A�����T���ʀ�t��f�K�����d@�����ff.�f�AT1�I��UH��SH��dH�%(H��$1����Å�u'H��$dH3%(��uQH��[]A\�fDH��H������Å�u"f�|$u�|$�A��x A�$���������?��@��AUA��ATI��/UH��L��SH��dH�%(H�D$1���?��H�����D��L��H��H���_����/��t(H�L$dH3%(��H��[]A\A]�f��}���f�}�A��t]H�sH�|$�����uK�D$D9�wB�f�E1�f U뙐D��L��H�������u��}���f�}��D���fD������^����>����������ta��uL� A�f�OfD�G�oFG��t�G9�uU�����1�H��f�Gf��|�1�H���D������f.�A�A�fD�OfD�W�F�G��u�뫸��������SH���H��H��dH�%(H��$1�H��������u H��$dH3%(�D$u3H��[�H��}!H�پH�L�H�81��ZC����0C���=��ff.���PXH�=S��0�H��H�n}!H��C���������B��ff.����PXH�K��H��H�3}!H��H�81���B��������B��ff.����PXH�3�H��H��|!I��H��H�81��B��������iB��f���PXH��H��H��|!H��I��H�81��SB��������)B��f���PXH��H��H�x|!H��I��H�81��B���������A��f���H��H�A|!H��H����H�81���A�������H���ff.���SH����;��H��w�;tH��[��������[Ð���?t��f�������f.���ATI��H��UH��S����Å�t��[]A\�DH��L���H:����[]A\Ð��SH��t&H�^H���Z������HE�H��[�f.�H�I{!�����H��H�81���@�����hBH���������t1���t%8�u!��fDH��8�u����u�����ff.���UH��SH��H�55�H��H�������u�E����H��1�[]�DH��H��H��1�[]���D��AUA��ATA��L�gUH�nS��H����t��H��L��Hc��;����u;E��t%� HcӸ����D)�E1���A��3L�ȅ�A��H��D��[]A\A]�H��A�����[D��]A\A]�@��USH��dH�%(H��$1�H��tS�WH��f��t%f�~H��H�������u5�SH��H������H��$dH3%(uH��[]�D1��ڸ�������X9�����UH�=��SH��(dH�%(H��$1��D7��H��tH�=���37��� 1�H���;���Å�tNH��$dH3%(���AH��([]��|$@B���\$H���n8����u�f.��d�f�H�=E��6��H��tH�=4�H�\$�6��H�����H��H��1��8��H�56�H����:��H��H��t�H��H�L$H�T$1�H�5��39�����R���H��d��7�������H�=���$6��H��t?H�=��H�\$�6��L����H��I�����1��5���a���fDfo���D$ H�\$)D$�?����7��ff.�@��H����<��H���f���I��H�ʃ�wQL���A��Kc�L�>��DIc�L��Xe����L����AA�f��t>f�� t H�����D��L���5��DI�sD��� ��4���I�sD�����4�����A�H� o�!�:���f.���I���H�=x��L����������H�=Y�L�Ƹ �����ta�H�=��L�Ƹ�����tA�H�=�L�Ƹ�����t!�H�=�L���������������H�����t9H����� t-H�O���t!H�����t��H���H���HD��fD��UH��S��H�����u H��1�[]�H�z���t���}���H��H�su!I��H�a��H�81�� ;�����:����UH��SH����t���w�����u3H��1�[]�H�#u!H��H�I��H�81��:����:��H�����t�����H��H��t!I��H�R��H�81��{:����Q:�����AWA��AVAUE��ATI��UH��S��H��8H���!����������� ��D�<$Ic�A��H�l$H�D$H�D�����H��H��H��(���Љ�)�H��!H��H�T$(H�D$ H��� �\$D��I���fDM�6M����A�F9�u�A�F9$u�H�T$H�t$I�~�V5����uʋ\$I�F�pD���D�HDI�A��E�σ��*���H��8E��L��H��D����[]A\A]A^A_�����U��u9�E��u2�}��u)H�EA�H�D$H�D$�$��DIc�A� D�<$H�D$H�D�H�l$�����A�ދ\$��G6��I��H���Z���fD�p�$I�x�H�T$H�t$L�D$fA�@I�@�4��H�D$ L�D$H�L$(I�H�o�!L�ȋE�!���<�!��tgH�pr!L�D$H�8��5���4$H�|$D���8��L�D$H��t1H�8L�$�]8��L�$I�@H�������H��8[]A\A]A^A_�DI�@��f��L�D$��6��L�D$�f.���A�H� ��!�J���f.���AWAVAUATUSH��H�T$��~`����~ZI��I��D�4�L�-���E�D�L��1�L��H������I���8��D��D)�����9���H���t�H�D$H��[]A\A]A^A_���AWAVAUI��ATU��SH��H��HH�L$dH�%(H�D$81��1��I��A����A������M�H�l$5H�L$H�L$(H�L$�t�H��H���/���D$7�/��H�t$�H���I���#6��A�$��uS=�wLH�T$(�:uBA��C�D5H��M�fL;t$tH��M���g0��E��H��w�H�L$L��H��tD�9�@1�H�L$8dH3%(uH��H[]A\A]A^A_��B0��f�����~_�B�ATL�dUH��SH���%@����}����xH��H��L9�t�}�f���y�[�����]A\��[1�]A\�1��fD��AWA��AVfA��L�5k�AUATI��UH��S1�H��H�|$L�l$L�|$H��L��H�|E��AVH)1�L���H�����I���-��E�MH�H�fA��XZM9�u�H��L��H�|E��H�I�H)�L�:�H�����P�1��J-��H��(H�H�[]A\A]A^A_�fD��H����AWAVL�5��AUATI��UH��SH��H�H���=5��I��f.�D�;I�UA��DJ@tA��\tD��L���/��H��t/D��L���1��2��H��H9�u�H��[]A\A]A^A_�DD����,����fD����U1�H��SH��HdH�%(H�D$81�H��H����.��H���,��H��!���tYH�\$H���(H��H���E2��L�D$H��H��H���1��3��1�H�L$8dH3%(uEH��H[]�fDH����-��H��H���-��H�پH���D�L�D$H���1��B3����{-��ff.���AVAUI��ATUH��S1�H��PdH�%(H�D$H1�H�B(H��t7D�`E��tnH��(���<����D���c4I��M��uSL��1�I��H����D��H�L$HdH3%(��H��P[]A\A]A^�@�S<L�5 ���uXI��H��I��AVL����@1��@L��L���*��XZ�z���f�E��1ɾ�H����%>�X���E1�1ɾ�H�����G�8���D����3I���;��uD����4�ЉÃ������M��1ɾ�H�|���CD���4�ЉÃ�������+��ff.����AWH��AVAUATUH��SH��XH�T$� H�t$dH�%(H�D$H1��t-��I��H��� H�]L�5m�!�#H��A���+��H��t�H�]H�D$@H�D$ H�D$8H�D$(���H�L$H�t$ � H�D$8H�D$@H�|$(�,��I��H����A��#�H�\$8H���`+��H��t�H�\$8L�}L���*��H��H�D$�*��H�L$L��H�tH�D$H�0�p.��H�EH����H�t$8H��O�l,��0��H�|$8��(��H�]H��H�5���0��H��H���(���H�T$HdH3%(L��uuH��X[]A\A]A^A_�fDH�Ij!��M��H�=��H���/���H�!j!��H�=~�I�����H��/��H�D$H��x�����)��ff.���AWI��AVAUATUSH���?��H��I��L�-A�1�D�r��1DI�$L��H����*��H8�}I���xH�X�tlL��H���*��H��3@��tVA9�~t��@��'t@��"u�H�{I�<$�)��H��u�H�9i!��H�=��H��.����.��fDHc�M�<�I�H����[]A\A]A^A_�1���H��h!��H�=}�H��m.����S.����ATUH��SH��D�fdH�%(H�D$1��FH��H�$�'��H���(��H��H���K(��M��H�پ�D�H��1�H��� .��H�D$dH3%(u H��[]A\��,(��ff.����SH��A��H� 8�H��H������1��.��H��[���AUATI��H��UH��SH��dH�%(H�D$1��'��H��unH�]H�uH���8:u[H��H9�u�I�$�8I��f�H�{��L����,��H9$u)H=�w!���H��H��I $���u�1�� ������H�T$dH3%(uH��[]A\A]��+'��ff.�����u"���t���� D��fD��f���UH��A��SH��H�� H���dH�%(H��$� 1�H�����EMc���A9���H�uI��roH�EH�zH��H��H�H)�J�D�H)�L�J�D�H���H�H9�t1�@�<H�<CH��H��`u�H��$� dH34%(D����H�ĸ []�A���]M��t���A��t�B�D�fB�D��D��Lc�)�Hc�J�H������1H���5������*���1�f�t������H�n8A�`H��H�����H�F`H�����H�PH�|$`A���(���֊H�T$xH��ttH�{H��H��H�Hǃ�H��H)�������H�H�BH�H�BH�CH�B,H�CH�B4H�CH�BlH�C H�BtH�C(H���H�C@H���H�ChA�����H�yH�H�D�H��H)�H�1�H���H�� �����B�D�B�D��C�����D����A������A����$��ff.���AUI��H��ATI��USH��H���A$��H��H��uH��H��[]A\A]�H��L��L��H9�HG�H����&��A�DH��H��[]A\A]�ff.���AUI��ATI��UH��SH����#��H��L9�rL����#��H��H�[]A\A]�fDL��H�|L��H)��=���H��H�[]A\A]�ff.�@��SH��dH�%(H�D$1��#����uH�D$dH3%(uiH��[���K$����t��&��H��H��tJH�L$��H���$����u/�D$��uH����'����uH���%����uH���'(����#����(��fD��ATI��UH��SH��H�� dH�%(H�D$1�H�t$�1"��H�\$H9��F�;u.�H,�A�$1�H�T$dH3%(�LH�� []A\�fDH�5سH���D$� ���D$����H�5̳H���� ���D$����H�5��H��� ���D$����H�5�H���D$� ���D$����H�5n�H��� ���D$����H�5V�H���d ���D$��tzH�5��H���D$�E ���D$�������H�5b�H���( ���D$������H�5J�H��� ���D$����������������Y�����Y������>!��ff.�����f�SH���H*���?Bwm���v5L�ٳ�^��H�ߺ�?H���������H��[�A��L���H��1�H�������?����H��[�fD�^X�L�f�����ATI��UH��SH��H�� dH�%(H�D$1�H�t$����H�\$H9����;u.�H,�I�$1�H�T$dH3%(��H�� []A\�fDH�5x�H���D$����D$���]H�5l�H���~���D$���@H�5T�H���a���D$���#H�5��H���D$�>���D$���H�5�H���!���D$����H�5��H������D$����H�5M�H���D$�����D$����H�5��H�������D$����H�5�H������D$����H�5��H���D$����D$�������H�5��H���g���D$���{���H�5��H���J���D$���^���������_���f��YX��E����Y@��5����Y+��(����q�����f�SH���H*�H���ɚ;^H��?B=H���~dL�'��^�H�ߺ�?H�������G��H��[�f��^��L�����^��L�����I��L�ǰH��1�H�������?����H��[�fD��AWAVAUATUSH��H�$H��8H�-s]!H�<$I��I��H�U@�t$dH�%(H��$(1�H�D$H�D$H��tH���H�=��������H��!L�l$L�d$�D$H�\$ ��f.�H�UL��L���!�H���tcH�|$�H��� ��t�L��H�މ�A�օ�t�H���!H�$�H���D�H��\!H�81��["���|$�D$u�@H�|$H��t���H��$(dH3%(�D$umH��8[]A\A]A^A_�H�<$H�5�����H��t H�U���������8�6"��H�$�H��I��H�\!H�81���!���D$�|���������AWAVM��AUI��ATUSH��H�|$H����H��I��1�f�H�t�A��H��tL��������H��I9�u�H��[!H�L$H���1��N�d�L�=��H�;�,!��H�;f�H�MH��tL���1��!��H�;H��L9�u�L��H�G�1�E1���� ��A���H��D��[]A\A]A^A_�f.�A���H�[!H�L$H��1��H�;� ��H�;���H��I�йH��R!��������H���f.���AWAVI��AUATUSH��8�/H�H�|$H�t$L�D$dH�%(H�L$(1Ʌ�~UI��L�l$$�6f��L��H�3A�ԅ�uhI�wH�T$�|$$A�օ�uTH����tH�;�:���I��H��u�1�H�L$�)H�L$H�H�L$(dH3%(uH��8[]A\A]A^A_�fD�������ff.������tH��������@H������ff.����H��tQUSH��H��H��t#H���@H���h����t$H��tH�;H��u�H�����[]�f.��CH��[]ø�����H��t*H�H��t$;wu�)�H�H��t9wtH��u�1��f.���ff.�����H��t'H�H��t!;wu�&DH�H��t9wtH��u�1��f.���ff.���@��H��t&H�H��t ;wu�%@H�H��t9wtH��u�1��f.���ff.���U��S1�H�����H�x�����H��u�H����[]�@��ATI���UH��SH�����H��t�H��I�$H�E1�[]A\ø����fD��H���(���H��t �@�H���f.�������������~�@��foU��G$ �H�GG�D�ff.�@�����~���H��D�������u�DH�WH�5s��1����f���H���!Sf��H��D�ϋ��u0M��t+D9 tQL�QI��1��DL��H��I��D9 t0I9�u�Hc�H��L�ũ1�H����������H��[�fDH�A[�f���AVI��AUATI��USH��tII��H��1���H��H��I9�t+H�{L��������u��[]A\f��A]fA�A^��1�L��L������[]��A\A]��A^�����AWI�AVI��AUI��ATI��USH��dH�%(H��$1�H��L��H���F��H�����$H��< u f�H���< t�< t�<#vM1�L��L��H��H�5k�������uA�H��$dH3%(��H��[]A\A]A^A_�I���p����@1�L��L��H��H�5������t�1�L��L��H��H�5��m����t�1�L��L��H��H�5��Q�����g���H��L������������W���1��P�������AWI���@AVI��H�5r�AUA��ATUSH��8H�|$H�\$ H��dH�%(H��$(1��H�L������H��tJH��L�d$f�H��L��H���B�����t&���tQD�|$E9�w�H���'��Ic�I����fDH�����H��$(dH3%(uDH��8[]A\A]A^A_�H��S!H�L$I��H�2��H�81����H���k������@AWAVAUATUSH��H�$H��H�=���H�5C�!dH�%(H��$1����!���H�=�����H����H��H�-��I��L�5��L�-�!�H�����H��tj�x.t�L�xL������H��v�I�t��H�������u�M��M����L�����L��L������H���.��H��u�H������H��$dH3%(uH��[]A\A]A^A_�����AWAVAUATUSH��H�$H��H�=߫dH�%(H��$1����!���H����H��H�-n�I��L�5ȫL�-��!f�H���x��H��tj�x.t�L�xL������H��v�I�t��H�������u�M��M����L������L�� L�����H�����H��u�H�����H��$dH3%(uH��[]A\A]A^A_��g���AW�@AVI��AUI��H�5 �ATUSH��(dH�%(H��$1�H�\$H���H�L�����H��trH��L�d$f.�H��L��H������tF���tq�D$��x����H��I�NjD$A�G����I�G�D$I�D�H�L�8I��H���P��H��$dH3%(uBH��([]A\A]A^A_�H��P!I��L��H�ĩ�H�81����H�������F��fDAWAVAUATUSH��H�$H��H� h!dH�%(H��$1����!f�H��H��t�BH��H=u�H�5Ah!H�=A��u���H�=M����H��H����H�-��I��L�5E�L�-h!DH�����H��te�x.t�L�xL���a��H��v�I�t��H�������u�M��M����L���v ��L��L������H�����H��u�H���V��H��$dH3%(uH��[]A\A]A^A_����ff.����ATUSH��H�����wZH���!���uMH�-�!Lc�J�D�H��tH��[]A\���:�!��u�T$�|$���J�D��|$�T$H��u�Hc�A��L���H��H������1����H��H��[]A\���AWI��AVI��AUATUSH��H�=��!dH�%(H�D$1�H��t ���������!����1�L�-�~!�fDH��H��tmI�l�Lc�H��t�L��H��������u�H�-�!L�% �!A�H�L$dH3%(umH��[]A\A]A^A_��H�ّ!A���@�����u���1�H��L������H�$H���!H��tL9�t�:uH=�wA�1�늸������4 ��@��AUA��ATUH��S��H�����wlH��!���u_L�%�u!Lc�K��H��tH��[]A\A]���n�!��u0�|$�L��H�=y��M�!����K��D�L$H��u�Hc�H��L�Ý1�H������� ��H��H��[]A\A]����AWI��AVI��AUATUSH��H�=��!dH�%(H�D$1�H��t �7���������!����1�L�-�t!�fDH��H����I�l�Lc�H��t�L��H���� ����u�H�-$�!L�%�!A�H�L$dH3%(��H��[]A\A]A^A_��H��!A���@�H�5Lt!H�=;���!�����P���1�H��L������H�$H���!H��tL9�t�:uH=�w A�1��f���������\����)��f���AUA��ATUH��S��H�����wlH��!���u_L�%�k!Lc�K��H��tH��[]A\A]���Z�!��u0�|$�L��H�=���9�!��K��D�L$H��u�Hc�H��L���1�H���������H��H��[]A\A]����AWI��AVI��AUATUSH��H�=y�!dH�%(H�D$1�H��t �'���������!����1�L�-�j!�fDH��H����I�l�Lc�H��t�L��H��������u�H�-�!L�%��!A�H�L$dH3%(��H��[]A\A]A^A_��H���!A���@�H�5<j!H�=C����!���P���1�H��L�����H�$H�y�!H��tL9�t�:uH=�w A�1��f���������\���� ��f���ATA�ԋ��!UH��S����tv��H�La!H��H��t;Yu�<@9Yt3H� H��u�Ic�A��H��H�����L���1�����H��[]A\�H���!���u�[H�A]A\�f.��;����f���AWI��AVAUATI��USH��H�=y�!dH�%(H�D$1�H��t �7 ���������!����L�-z`!M��I�]H��u�UDH�H��tHH�kL��H���� ����u�KH�-�!H� �!A�H�L$dH3%(uhH��[]A\A]A^A_�f�I��M9�u�1�H��L�����H�$H��t1L9�t,�:u'�����H9�wA�1��H���!A���%����?����������T��@�����wTUH�-�W!SHc�H��H�D�H��t H��[]����!��u�H��H�=����!�H�H�D��ǐ1��ff.�f���ATA��I��L���UHc�S�Ӂ��wH���!���t/Hc�A��L���L��H������1����L��[]A\�@�+���H��t�[]A\Ð��AWI��AVI��AUATUSH��H�=i�!dH�%(H�D$1�H��t �7���������!����1�L�-xV!�fDH��H����I�l�Lc�H��t�L��H��������u�H�-�!L�%�!A�H�L$dH3%(��H��[]A\A]A^A_��H���!A���@�H�5�U!H�=k���!����P����H��L��� ��H�$H�f�!H��tL9�t�:uH=�w A�1��c���������Y����&��fD��AWI��AVAUATI��USH��H�= �!dH�%(H�D$1�H��t ���������]�!����L�- M!M��I�]H��u�UDH�H��tHH�kL��H�������u�KH�-��!H� ��!A�H�L$dH3%(u}H��[]A\A]A^A_�f�I��M9�u�1�H��L������H�$H��tCL9�t>�:u9��x5A�1��H�%�!A��H�5YL!H�=����!���-���������s�������ff.�@��ATA�ԋU�!UH��S����t~H���!���uBH�5�K!H��H�H��u�!�H� H��t9Yu�H�A[]A\�f.�H��H9�u�Ic�A��L���H��H������1����H����H�5�K!H�=@����!����`���fD��UA��H��S��H�����w6H��!���u)�s�!��tOIc�H�%C!H��H��tlH��[]�DHc�H��L��1�H����������H��H��[]�fD�|$�H�5�B!H�=�����!���D�L$�Hc�H��L���H���������H��H��[]����AWI��AVI��AUATUSH��H�=�!dH�%(H�D$1�H��t ��������y�!����1�L�-(B!�fDH��H����I�l�Lc�H��t�L��H�������u�H�-��!L�%��!A�H�L$dH3%(��H��[]A\A]A^A_��H�a�!A���@�H�5�A!H�=o��ˆ!���P���1�H��L�����H�$H��!H��tL9�t�:uH=�w A�1��f���������\������f���ATUSH������H���!I��A��Hcڋ(������!��t7Ic�H�-�!H��H��t4H���H��L��1�� ��H����[]A\�D�|$��D�L$�H��L��L���1�H���������H����[]A\�DH��L��L�]�1�H������1��N���H����[]A\�������v���fD��AWI��AVI��AUATUSH��H�=Ƀ!dH�%(H�D$1�H��t ���������!����1�L�-(�!�fDH��H�� tfI�l�Lc�H��t�L��H���~����u�H�-[�!L�%L�!A�H�L$dH3%(uuH��[]A\A]A^A_�f.�H��!A���@1�H��L�����H�$H���!H��t%L9�t �:uH��wA�1��@�s��=���������{�������f.�DH�GH�WH�H��tH�P@��tH�H�WH�H��tH�P�����H�W0H�G8H�BH�����@UH��SH��H�G0H�H�x�H��0H9�u��H��1����H�C0H��H��0H9�u�H��[]�ff.�@������t��H���������u����AWAVI��H��AUI��ATUH��SH�����H�xAI�����H��H��t~E�~H�x@I�T$L��D�x$�t��A�Ff�C(A�F�C H�C0H��tcH�U8H�E8H��0H�k0H�S8H�L���L���H�U�!H�s%�H��H�KH��tH�qH�4�H��H�CH��H��[]A\A]A^A_�DH��!A��J��H�H��tH�YJ��J��H�SH�C0H�C8�@H���H����AUATL�`USH��D�(A��A��~\�@f��vRH��H��A9�}�EDA�$f��v5D9�0fA�|$5uI�t$H��H�����A�$����A)�I�A���H��[]A\A]�D����AWAVAUATUSH���WdH�%(H��$1��B�f�����H�����%�GH�oH�5�!�ǁ�L�,�M��u�eDM�mM���SA;E$u�f����H�|$�� H�S A���>H�|$�aH�|$(H��td�CL�wI�}@L��A�E �����tII�EI�UH�H��tH�PL���A���H�J�!I�u%�H��I�MH��tH�qH�4�H��I�EH��$�H���3D�8I�M0L�pA��L�a�A��~e�@f��v[��D9�~�QDA�f��vB��A9�|:fA�~5u M��t5I�t$@I�~������u#I�T$0L�bЍC��A)�I�A���I�|$00tlL���$���H�T$H��L�����1��Rf��tJL�d$�� H�S A���>L����_H�D$(H��t!1�H�pH���S���H��tL��H��H���@���1�H��$dH3%(u>H��[]A\A]A^A_�L������L���4���1���L���x���1�붸���������AU��I��f�ATU1�SH��dH�%(H��$x1�H�\$PL�d$)D$H��)D$ )D$0H�D$@�H��t$dL��1�H� H�D$P�MD����� �� H���YM��t1L���!���L��h�6���A��L�� ��H��҃��5��XH�T$H��L��1��R��xH�|$1����H�|$�Ņ�u�o�#���L���AH��$xdH3%(��uH�Ĉ[]A\A]������H��A��L�k�1����H�=F~!���H�:~!H���D��ATUSH�3���t.��L�%4�!��I��H��u �#H�H��t;x$u�H�X@H��[]A\������1��5���9�u!I��H��u�fDH�H��t;h$u�뾐H�5�}!��H��}!�{���H��u�A���H��L������������t@��H��!��H�и����H��u�f�H�H��t;z$u��B(�fD������f���1���t6��H�-�!��H�и����H��u��H�H��t;z$u�B ��������f���ATUS1�H��dH�%(H�D$1�H��tIH�����H��|!%�H��H��u�NfDH�H��t@H�{0H��L�c������u�M��t'�[H�L$dH3%(��uQH��[]A\�f�1�H������Å�u�H�������Å�u�1�H�T$H�5!�H�������u��\$��<���ff.������H��!��H��H��u�Cf�H�H��t8;x$u�H�H�HH�H��tH�JH�PH�HH�H��tH�JH����@��ff.����V{!��tÐS1�H����G��x#H�5:���1�1�H���.M��x"� {![�H�=K��R��������H�q5!��H�==�H���������f.�@��AWAVAUI��ATUSH�������t=�������>���6H��L��H��D��[�]A\A]A^A_�!D���t��7�hMc�D���I��1�L���L��L��H������L��L�l$��A��~h��~cL��M�}A�L�L�5`�H�$fDH�4$G�L,�L��1��M��H�����L)��b�C�Dm�9���D9���I��I����u�H�D$H��[]A\A]A^A_�f��Ѓ�=t�� �0���H��D��L��H��[]A\A]A^A_������u,��t(H��L��H��D��[�]A\A]A^A_�#�������������H��L��H��D��[�]A\A]A^A_�� f.�H��D��L�� �c���ff.�f���AWAVAUI��H��ATUH��S��.H��8dH�%(H��$(1��c�H��tVH�|$ �H���ܯ��������������H��$(dH3%(�)H��8[]A\A]A^A_�D���D�c�L�|$I�D$L�5��A�H�D$�0fD�D$=�wPC�D%�D��H��t�I��H��L;d$���:H����H��H��t�H��1�L��L��H�������t�H�2!H��H���H�81�������������H��1!H��H�H�81�����������fD�D$(A�E�����fD��������������u�H�Q1!S��H�8�&$H�?�!H��t8H�O�!���u ��u[���H���$��t�H�=�![�R&H�=;��������ff.������r���f���H�=Ŷ!H��t H���7&H�=��!H���#��ff.�@��1��%���D��H�=t�!tH�=k�!�v#fD�ff.�@��H�=D�!���AWM��AVI��AUA��ATI��U��SD��H��������t8@��t2��H�=�!M��tcL����'H��1�[]A\A]A^A_�f.������u܃�t�H��/!L��L��D��H�8H��1�[]A\A]A^A_�*f.����%����H���!�@��SH���#�����t'H�=h�!H��tH����"H�=T�![�N$fD[�fD��H�������uH���f.�H�=�!H��� $��UH��S��H�������t0��t+H�=�!H��tH���o"H�=ش!H��[]�$D�s�����u��u H��[]�H��H��[H�5�]���fD��UH��S��H���,�����t��u������u��u%H��[]�fDH�=Q�!H��[]��#fDH��H��[H�5�]�V�fD��AVI��AUA��ATE��UH��S�������t-��t(H�=�!H��tLD��H���a'[1�]A\A]A^�fD�{�����u��t�H��-![D��L��]D��A\H�8A]1�A^� D���$[1�]A\A]A^�ff.�f���AVI��AUA��ATM��UH��S��������t-��t(H�=Q�!H��tLL��H����&[1�]A\A]A^�fD������u��t�H�-![L��L��]D��A\H�8A]1�A^� L���x$[1�]A\A]A^�ff.�f���AVI��AUI��ATA��U��SD���q�����t-@��t'��H�=��!M��tHL���`%[1�]A\A]A^�D�;�����u��t�H�{,!��L��[D��]A\H�8A]1�A^������"[1�]A\A]A^�ff.���AVI��AUI��ATA��U��SD��������t-@��t'��H�= �!M��tHL����$[1�]A\A]A^�D�����u��t�H��+!��L��[D��]A\H�8A]1�A^�@���i"[1�]A\A]A^�ff.���AVI��AUA��ATE��UH��S���1�����t-��t(H�=q�!H��tLD��H���#[1�]A\A]A^�fD�����u��t�H�;+![D��L��]D��A\H�8A]1�A^�D����![1�]A\A]A^�ff.�f���AVI��AUA��ATM��UH��S�������t-��t(H�=Ѱ!H��tLL��H���!#[1�]A\A]A^�fD�[�����u��t�H��*![L��L��]D��A\H�8A]1�A^�L���h![1�]A\A]A^�ff.�f���AVI��AUA��ATM��UH��S������t-��t(H�=1�!H��tLL��H���A#[1�]A\A]A^�fD�����u��t�H��)![L��L��]D��A\H�8A]1�A^�` L���![1�]A\A]A^�ff.�f���AVI��AUA��ATM��UH��S���Q�����t-��t(H�=��!H��tLL��H����"[1�]A\A]A^�fD������u��t�H�[)![L��L��]D��A\H�8A]1�A^� L���x [1�]A\A]A^�ff.�f���AUI��ATA��UH��S��H���D$�����t0��t+H�=�!�D$H��tQH���� H��1�[]A\A]�@�s�����u��t�H��(!�D$L��D��H�8H���[]A\A]� �H��1�[]A\A]�ff.���ATI��A��L���U�@��@SH��H��PdH�%(H�D$H1�H��H���z�E��H��H�ھ��r���H�D$HdH3%(u H��P[]A\���@��AVI��AUA��ATM��UH��S�������t=��t8H�=��!H��tM��tWH��ujM��teL���[1�]A\A]A^�f.��;�����u��t�H�{'![L��L��]D��A\H�8A]1�A^��H����[1�]A\A]A^�DL��H����[1�]A\A]A^�f���ATI��I��L�p�U�@��@SH��H��PdH�%(H�D$H1�H��H���:�M��H��H�ھ����H�D$HdH3%(u H��P[]A\����@��E��L� ��E��H���LD��N���ff.���E��L� �pE��H��pLD�����ff.���AVI��AUI��ATA��UL��S��H��PdH�%(H�D$H1�������t��u\���1҄�t)H�L$HdH3%(���H��P[]A\A]A^�fD��t�H��%!L��H��D��H�81��A���DH��I��L��1��@��@H�����L��I��1ɾ����1��k�����ff.�@��AVI��AUI��ATA��UD��S��H��PdH�%(H�D$H1�����t��u\���1҄�t)H�L$HdH3%(����H��P[]A\A]A^�fD��t�H��$!L���D��H�81��R���fDH��1�A��@L��~��@H�����M��tH�=��!H��L���+1��k���@H�=y�!H���Q1��Q�����D��AVM��AUI��ATA��UH��S������t-��t(H�=1�!H��tLH���[1�]A\A]A^�f����u��t�H��#![L��L��]D��A\H�8A]1�A^�`�+[1�]A\A]A^���f��f��I*�I*@�^�z�X�������H�=��!tÐH��#!H�5u�H�1�����AWAVM��L��{AUI��ATA��U��SL��H��(dH�%(H�D$1�@��H�_�M�I���I��@��LD�L�D$��L�D$��t @����H��L9���Ii��1�H��1�I��H��t H9�����H�Ã�tL9�s�Hc�H�6!H���H� jf�H�|$���H*�H��|�U�����L�D$��L��L��D���x���H�|$����H�L$dH3%(��u\H��([]A\A]A^A_�Hc�H��!H�Ѕ��y���L�L�L���j���I��H� q|L��D����9�����뙻������ �f�����������H����t#H��!!H�8������ ���u 1�H���f�H�=|���!����H��tE�;H���8�H���H��t��A�PЀ���<8���t�yu��Q�!��H���fD1��ff.�f���UH��AUATSH��dH�%(H�E�1�H����H��I�����H��H�PH��H��H%�H)�H���H��H9�tH��H��$�H9�u����H�|$L��H����w��=H��I���7��8I����H�5�zL���|�����upA�<$���H�=�zL�������tk�H�=hiL�������u���&@�H�=�zL�������t^fD1�H�U�dH3%(uTH�e�[A\A]]�@�����I���A���@H)�H�L�����f.�������ff.���ATI��UH��SH���H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1���!H��$��$H�D$H�D$ �D$0H�D$���������ڤ!������H��y��H�s!�H��H��H�p1��y�H��L��H����T��H� y�H���H��o1��E����H�\$dH3%(u4H���[]A\�H�Iy���w����H��L��H��������6��fD���@��t 1�@�� ���D@����@��t 1�@�����D�AUATUSH��H�$H��H�5�{H�=�xdH�%(H��$�1��1�H����H��H��L��$�L�-Ey���H��L�������tJ1�H��L��H��H�5�x�c����t�1�H�����H��$�dH3%(H��uKH�Ę[]A\A]�L���(�H��������1ۋ8�%�H��y�H��H�!H�81��������ff.���AUA��ATUSH�����H����1��8/I��@��H��)�D��L������Ņ����{�/H�{���/����H��H��u�D��L���z���Ņ�tl����8��t`�c�L��H��wI��H�J!H�81����L���h��H����[]A\A]������8��u��{�/H�{�t���1��ĺH��!�H�=3w�����H����ff.�f���U��SH�����H��H��tH��H��[]�D@����H�=1w��H��H�����H���������E1�1�H�wH��H�=w�7����tK����8��t?�����9�H��v�H��H�#!H�81����H���A���U���@��H��H��H��[]��H��!��H�=SvH��p�����H��!�"�H�=�wH��H�H���������H��!�=�H�=�wH����Z���H�i!�+�H�= wH��������ff.���AWf�AVAUATUSH��8dH�%(H�D$(1�)D$H����L�t$L�l$H��E1�H��L��L�꿜����D$�!����xI�|$��H�l$E1�L������H�T$(dH3%(H����H��8[]A\A]A^A_�@H���</t�����1�1����I��H��t�H��1�1����A�Dž���E1�L��L��H�މ��D$��������|$��H�l$D���"���S���DH�!��1�H�=�tH�����/������1�E1�H��!H�=�tH��k�����fD��1�E1�H��!H�=otH��;������fDH��!��H�=ZtH�������H�a!��H�=ntH��������������8�7��H�0t�H��H�!!H�81�����������ff.�f���AWAVAUATUSH��H�$H��hf�dH�%(H��$X1�)$H���H��1�A�����H��H���5H��1�1�����A�ą��.H��1�D��H�l$H�H�$����Ņ��4L�|$A��1���@L���@L��sL�l$P�W����L��L��������H��DPE��t[L�����I��M���/�����D������H�����L��H��$XdH3%(�#H��h[]A\A]A^A_�@H�����I�|���I��뙐��1�E1�H��!H�=�rH�����f�E1��x����H�Y!��E1�H�='rH������H����H�)!��E1�H�=crH���������H��!L���E1�H�GsH�81���������H��!�+�H�=�rH��P��������fD��AVAUATUSH��H�$H��L��q�dH�%(H��$�1�H��$�I��I��I�վ�H���_��=���H�5�rH�����H��H����A�$H��L�5�qH�꾀H���z��H��tWL��H���*��H��t�H�X�<��H���H��H��DB u� H�����H��t�L��H��L������H���6��1�H��$�dH3%(uH�Đ[]A\A]A^ø�������U��D��ATUSH��H�$H��dH�%(H��$1�����H��A��L��pH��H�߹�I��1���!��H��H�5�q�b��H��H��tZH��D��H���\��H��tGH�5�rH�����H���D�[��1�H��$dH3%(uH��[]A\�f.���������t��@��H��H��L�WI����M�H�� t A�I�PM��I��H��I9�u�A�-�W����ʀ� ~A�@1M�H�� ��0A�AA� ���t ��-t��*f��ff.�@��AUA��ATI��UH��S��H�������t�aH��1�[]A\A]�f.��H��D��L��[H��]A\A]����f���AUA��ATI��U��SH��H���"��A��uT��� va1�E�<A��A��0D�{E�<A��A��0D�D{H��H��u�H�� t�C H��[]A\A]��aH��1�[]A\A]�D1���f.�f���AWAVI��AUATI��UH��S��H���~��I�ǃ�t�aH��1�[]A\A]A^A_���L���"DI��A��ucH�H���/H�H��E�L��kH��H��H������1�A�E��E��A���k��H�H9�w�A�����H��1�[]A\A]A^A_�@H��L��[]A\A]A^A_�fD��AUH��I��ATA��UH��SH��H��dH�%(H�D$1����A�������tq�E�H��L�d��-@H�$L9�t5��ȉ� ��tq��/u"H��L�jI9�t71�H��L������H=��v�1�H�t$dH34%(uUH��[]A\A]�DH�Q!��H�=�mH�����1��@ ���f��a���������f.�@��AUA��ATI��UH��S��H�������t�aH��1�[]A\A]�f.��H��D��L��[H��]A\A]�"���f�U��SH��H��H�7� @��u!�C ,���~���C�C H��[]���c��H�3��ff.�ATUH��SH�7� �<���E��t+1�L�%dE@H�M�L�������;]r�[]A\�DPXH� �l��H�5�lH�=�lH�����ff.�ATL�%�lUH��SH��H�7�"����;@��uF�D@�� �@�� ��@����H���z��f.�H���;@��t@H�M@��tJ~�@��"tz@��\tT@�� u�H�=l��H�������;@��u�H�u[�"]A\���f���L������@��H�=�k����m���D��H�=�k�b���M���D��H�=tk�B���-���D��H�=Kk�"��� ���D��H�=(k������ff.�f���SH����n��H��t1�H��@f�P[����USH��H��C��u/H�3H��� �,��H�;�4��H�����H�EH��[]�H� �j�kH�5mjH�=�j�n��ff.���@�w����UH��SH��H��� @��u?�{�C ,tH���%����C H��H�����H�3�:�Y���{uH��[]�@H�3�@���fDH�3H��� []�%��D��UH��SH��H���H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��$�H�;�$H�D$H�D$ H�D$�C �D$0��u5�C ,H��H��� ��H�D$dH3%(u H���[]��H�����>��H�;��$��@���{���f���S�G��t-��� H���Gt�t���H�3�}�����C ,[����f���S�[H���.����{u[�fDH�3� [���f���S�H��t� u,�C�C ��t0��H�3�]�C�~���C ,[��H�7� �c�����\���ff.����UH��SH��H��� @��u�C ,H��H��H��[]�R���f�H�3�����fD��@��H�1dH�%dHD�H�5>[1�����f���H�5�g1����ff.���H�5�g����ff.���@��1�H�5~g�j���f.�����1�H�5dg�K���ff.�����1�H�5qc�,���ff.����H��1�H�5(g����ff.���H��1�H�5g���ff.����f.���H��1�H�5c���ff.�����1�H�5�Y���ff.����H��1�H�5�f�{���ff.���UH��SH��H������H��H��H��[]����f.���UH��S��H�����H����H��[]�+���ff.���SH��H���D$�y����D$H��H��[�F���fD��U��SH��H���L���H����H��[]�|���ff.����UH��SH��H������H��H��H��[]�j���f.���UH��SH��H�����H��H��H��[]�Z���f.���UH��S��H�����H����H��[]���ff.���UH��S��H�����H����H��[]���ff.���UH��SH��H���[���H��H��H��[]���f.���UH��SH��H���+���H��H��H��[]����f.���U��SH��H�����H����H��[]���ff.����UH��SH��H������H��H��H��[]���f.���SH�����H��[�Z���f.�UH�TdI��H� DdSH�`WH��H��H�-!@��HD�1�H�}���H������|�.tH�u�.���H�uH��� []����H��8f�1ɺ dH�%(H�D$(1�D$H� H�$�G@�t$H���D$�G�G �?�D$���H�T$(dH3%(uH��8��=��ff.�f���AUATI��USH��H��������x>H������H��D��H�hhIcՋ4��}����xIK��H���[]A\A]�DH��!��H�=�bH��`��H�������[]A\A]�H��!D��H��eH�81��@��H�������[]A\A]�AVA��AUI��ATA��US�D��L��D���J��� �yT����H�Ń�t݃�t؉��9��A�ؾH�beH��H� !H�81������U[]A\��A]A^���fD��t[��]A\A]A^�H��!��H�='bH��q��������f.�AWAVAUI�պ"ATA��UH��SH��L�vI�I�F������x<=���L�Hc�H�����I��H��tOI�1�H��D��I�^������xM�}H��[]A\A]A^A_�DL���D$�\����D$H��[]A\A]A^A_�H�!� �H�=YdH�������f���AUf�ATUH��SH��H��XdH�%(H�D$H1�)D$)D$ )D$0H�D$@����S��t*I�ľ����H�L$H�E���H���=����t(1�H�L$HdH3%(��H��X[]A\A]��L�l$M��tL������I��H�T$ 1�H��t H���G����9rqI�T$�C�HE�H��t"L����H�x�����p�^����M���g���A�}�\���A�$1�L������ljD$����D$�<���f�H��!�&�H�=cH��0��1�1��x����r���f�AWf�AVAUI���ATI��UH��1�SH��D�D$/dH�%(H��$�1�H�D$DD$lD$|H�D$Ff�L$Nf�|$DHDŽ$�DŽ$�H�D$`�D$hH�t$pH�T$xH����A�E�x����@��H��9�tH��BH��u�f�JH��9�u�B�\'�A�]H�D$`A�}1�H��H�D$衿������H�D$PH�l$H�D$pH�D$8H�D$xH�D$H�D$ �D$H�T$ H�t$A�}�D$(���A�Dž����L$h����H�l$8��D�uD����E9����D$H��uWA�E9EuN�E9�wG��L)�H9�r=f�}�;H�|$��H�� ��H�=�^H��N��fDA��A��E)�L�A���p���H�|$8趽����$� ��E���H�D$H�hH�l$���H�l$E���H����H�}�H��$�dH3<%(D����H�Ĩ[]A\A]A^A_�@H� � H�8��$� �WH����A�����H�=r]�y��H�|$8����H�� ��H�=�]H��M��H�D$H�h�9���D�}����E�����4���D���ډA�}$t?�|$/t81�H���u�����u*�}���W��H�&]�H��H�A� H�81�����H�l$H�|$8H��I9������K������H�l$H�D$8E1�H�E���1��P���1�H�����붺H�� �H�=�\A�����H��g��H�|$8����x���H�=\A������v���a���D��H�>\�1��;������H��[H�s� �H�81����������E���D��H�`\���t�������j���D�|$(A�����ff.�f���Sf��H����H��PdH�%(H�D$H1�H�L$)D$)D$ )D$0H�D$@蘼����u#H�|$H��t�d���H��H��t�8u'�1�H�\$HdH3%(u&H��P[��1������ljD$�N����D$���c���AWf�AVE1�AUATI��USH��H�t$dH�%(H��$�1�H�D$4D$\H�D$PH�D$@H�D$`H�D$(H�D$H�D$PD$lH�D$|DŽ$��D$XH�D$hH�D$H�T$H�t$A�<$�����Å��I�L$(L�|$(H��t�PL������G���L�|$(H�D$H�8��L�h(�D$���fDA�7�����9�s3��A�����)�Ilj���A�7����9���A�E��T$8��fA#GfA�G��u�A�T$A9Wu�A�|$ A9u���DE�A�Gf���Zf����I�|$(�t���I�u�L��A�U��a���H�|$(�$����$H��$�dH3%(�]H�Ę[]A\A]A^A_��I�}L�|$(tI��(�����I�}��u�L���$胸���D$�$�����$� �����H���H�'� H�5Y�H�81�����藿�����#�A�O�$蛸���$��މ0A�|$$t:I�E�H��tI�u�L���Ш�`���A�D$0��H�|$(�ڷ�������������t��u���@A�W���!�҉$yn�'����$H�ʼn�؉EI�E�H��t�$I�u�L���Ћ$�uJ�L���!�����u��E��Z����_�t������k���H�=TX����Z���1�L������I�}L�|$(���D$�s���H�� ��H�=�WH��g�������L�������$� ����H��� ��H�=�WH��,������H��� �$�H�=ZH��������H�[� ��H�=vWH��������(���D��E���{���H�%� �.�H�=�YH�謽��1��T���L���-���D�������SH��A���H���?dH�%(H�D$1�H�L$�D$� �����x�K0H�D$dH3%(uH��[��}���ff.�f���H���?A���t$H�L$��ȶ��H��������y�DSH�����5��������[�ff.�f���ATf�A��USH��H�� dH�%(H�D$1�G H�G0�W$G��D$��D$�U�������0H�L$A���Ǿ�������-H� @/!�;A�����������;��H�kH�L$A����1��D�cf�S�;�H���Cf�C �8��������;H�T$H���D$�I��������L$��ud�Kf��u.1��Ǹ���C1�H�t$dH34%(��H�� []A\�DH�}UH��� �H�81��S���H���K���������H�8U��H�=�T�O���������H�=�T�<�����H�=�T�.����H�=�T� ����H�=�T������+���ff.���1�����D��U�SH��H��dH�%(H��$�1�H�|$H��H�D$HDŽ$��H�@�t$H�jH�$�C���C�C �D$H��t��H��҅�u�;1ɺ�H�����H��$�dH3%(u H�Ĩ[]��_���ff.�@��U�SH��H��dH�%(H��$�1�H�|$H��H�D$HDŽ$��H�@�t$H�vH�$�C���C�C �D$H��t��H��҅�u�;1ɺ�H���!���H��$�dH3%(u H�Ĩ[]�蟳��ff.�@��U�SH��H��dH�%(H��$�1�H�|$H��H�D$HDŽ$��H�@�t$H�H�$�C���C�C �D$H��t��H��҅�u�;1ɺ�H���a���H��$�dH3%(u H�Ĩ[]��߲��ff.�@��H��8f�1ɺdH�%(H�D$(1�D$H�JH�$�G@�t$H���G�G �?�D$�۲��H�T$(dH3%(uH��8��a������USH��H��dH�%(H��$�1�H�|$H�L$H��H�D$H��HDŽ$�H)�������H�@�t$H�H�$�C���C�C �D$H��t��H��҅�u�;1ɺ�H���!���H��$�dH3%(u H�ĸ[]�蟱��ff.�@��H��8f�1ɺdH�%(H�D$(1�D$H�"H�$�G@�t$H���G�G �?�D$蛱��H�T$(dH3%(uH��8��!������U�#SH��H��8dH�%(H��$(1�H��H���H�@�t$H�H�$�C���C�C ��D$H��t�H��҅�u�;1ɺH������H��$(dH3%(u H��8[]�耰����H��(1ɺdH�%(H�D$1�H�BH�D$H�$�G@�t$H���G�G �?�D$苰��H�T$dH3%(uH��(��������H��(1ɺdH�%(H�D$1��D$H�VH�$�GH�D$��@�t$H��G�G �?�D$����H�T$dH3%(uH��(�虯��f���H��(1ɺdH�%(H�D$1�H�RH�D$H�$�G@�t$H���G�G �?�D$蛯��H�T$dH3%(uH��(��!������U��SH��H��(dH�%(H��$1�H��H���H�@�t$H�ZH�$�C���C�C ��D$H��t:�H��҅�u�$�;1�H������H��$dH3%(uH��([]ø�����{���ff.���H��8dH�%(H�D$(1���t$��t��H�L$(dH3%(u]H��8�DH�(f�T$$1�H�$�G�(D$��@�t$H��G�G �?�D$�D$�D$ �?�����ح�������t����F���fD��USH��H��8dH�%(H��$(1���t��ulH��1���H���H�@�t$H� H�$�C���C�C �D$���H��t� H��҅�t)H��$(dH3%(u'H��8[]�@�c��ؐ�$�;1�H���a��������f.���UH��SH��H��dH�%(H��$�1�H�|$H�L$H��H�D$H��HDŽ$�H)�������H��D$H��H� H�$�C���C�C �D$�҅�u�;1ɺ�H��賬��H��$�dH3%(u H�ĸ[]��1������UI�ɹSH��H��dH�%(H��$�1�H��H�D$HDž�H�}�H�@�t$H�^H�$�C�T$���C�C �D$M��t L��H��A�х�u�;1ɺ�H�����H��$�dH3%(u H�ĸ[]��{���ff.���H���?Hc�1�輫��H������UH��Hc�1�SH���?dH�%(H��$1�聫��� �x_H��}�B�H���c�����xg��~<�$��v4��9�r.f�|$u�bf����v9�rf�{tN����)�HӃ��1�H��$dH3<%(��ufH��[]�D�S���1҃8��������#v�6����S�ډ������H�q� ��H�=%IH�����������<���ff.����H��f�A�dH�%(H��$�1��Af�t$1��D$�Hc�f�D$�Gf�t$H�t$ ��H�T$p1҉G�G �?�D$H�D$H�D$`H�D$H�D$ H�D$`D$,D$<�D$H�D$fD�D$H�D$hH�L$xH�D$L�D$T�D$(H�D$0H�D$8�v���H��$�dH3%(uH�Ę��6���fD��H��hf��dH�%(H�D$X1�1�D$,f�D$�f�NH�D$H�D$H�D$ H�D$H�D$0�G�F��f�T$1҉G�G �?�FH�t$H�t$ D$<H�D$H�D$L�D$T�D$(H�D$8衧��H�L$XdH3%(uH��h��g������H��hf�dH�%(H�D$X1�H�4$H��)D$ H�T$)D$)D$0)D$@f�L$ ��H�T$XdH3%(uH��h�������H��hf�dH�%(H�D$X1�1�H�4$H��H�T$D$"D$2H�D$B�D$Jf�D$NH�L$L�D$fD�L$ �A�H�T$XdH3%(uH��h�臧�����H��(H��A��dH�%(H�D$1��H�4$H��H�D$���H�L$dH3%(uH��(��-���ff.�f���ATA��UH��SH��dH�%(H�D$1�f�NH���q����Å�u2D�����1��<���H��� H�<$H�0���g����ҵ��H�<$���H�L$dH3%(��u H��[]A\�虦��f���A������H��(H��E1��dH�%(H�D$1��H�4$H��H�D$���H�L$dH3%(uH��(��0�����SH��A���H���?dH�%(H�D$1�H�L$�D$�p�����x�K01�H�T$dH3%(uH��[�H�=�E褪���������踥�����AWAVAUATUSL��$���H��H�$L9�u�H��f�H�<$H�պI��dH�%(H��$�`1�1�D$Lf�D$.H�D$$H�D$@H�D$0H�D$PH��$� H�D$H�D$0H�D$@H�D$H��$�D$\H�D$&f�T$$H�D$l�D$t�D$HH�D$XH�D$H�$�@0tH�D$h H�D$H�D$`H�$H�t$1�H�D$8@�8覨��� ��|�W����I�ƃ�t���t���葪��A�ؾH��EH��H�x� H�81�����A�>i�v���@�����H��$�`dH3%(�H�Ę`[]A\A]A^A_�f����L$H����H�$�A0��A�Ń��]D��$� D����xsA9�nL�t$H�\$ �f�E�>D����xUE9�PH��L��H��A�ԅ��a���A��A��E)�M�D��A��w�D$p ��E���������H��B�9H�y� H�8�D$p �FH����H�=�A�����DL�D$h�D$ ����I���"���H�|$`H������E1�A�����I�H�H�H��H�ރ�H��H9_t?H��v!M��I)�I9�rI)�I9�rH��H��H�u��E�������D�T$ ���DH��u�D�WA��D$p � ���H��� ��H�=�AH��������H�o� ��H�=�@H������H�?BH�C� �H�81�����躧������D��H��@�1�迧����ff.�f���AWAVAUATUSL��$���H��H�$L9�u�H��I��H��I��I��dH�%(H��$@1�M�l$�P�H��um�$�C�=�?���� I����?��L��H��蓥��H9�u91�L��L��A�ׅ�xKH���L��蚠��H��u�H��荣������H���M�������H���m�����ui�����H��$@dH3%(��H��@[]A\A]A^A_�H�������پH��BI��H��� H�81��n����������H��� �"�H�=�BH��0���������r���fDH�=�@�D����J���1��T����S�����UA�hSH����H����x��/9�w@H�E�Hf�WfD�E��u�1�H��[]�fDH��Ic�H��蹢����������H��� ��H�=B�H�81�莥�����������E1�1��b���f���H��A��L$H�L$�D���H���ff.�@��H��A�f�L$H�L$����H���ff.���H��A��L$H�L$���H���ff.�@��U�#SH��H��(dH�%(H��$1�H��H���H���@�t$�H�r�H��H�$�C���C�C �D$�h����;1ɺH������H��$dH3%(u H��([]�腞��D��H��A�H�L$H�L$����H���ff.���AUA��ATA��UH��H��SH��H������H��H��D��[D��D�@H��]A\A]���ff.�@��AUATUH��S�Y��H����x��9�wRI��Lc�H�A��L��L��胠���E��1�D)�x��L�H�舞���E�����1��]H��[]A\A]�DH��� ��H�@�H�81��)����������f����SE1�1ɍX��H����H��[Ð����P��H�H)�f�>�f.���AUA��ATA��UH��SH����X��H����D��D��H�����H��H��[]A\A]�ff.�f����SH��������H���H)�H�f�H���`����[�ff.���������D�@A9�w*H�f�P�f��H������f�1��fDH��H�U� ��H��>�H�81���������H�����UA�@SH����H���?�����9�wNH�A�hf�Wf�/E��u*��������*f�1�H��[]�f.�H��Ic�H���q�����H��� ��H��>�H�81��P���������f���H��A��L$H�L$�D���H���ff.�@��H��A�f�L$H�L$����H���ff.���H��A�H�L$H�L$���H���ff.���S�E1�1Ƀ���H����H��f�K�[�������%��H�H)�f���@��AUE��ATA��UH�ՍV1�SHc҉�H��H���V�����~qI���EA��f��vw9�|sD����'fD����)�HŃ�~@�EA��f��vI9�|E�U!���D9����I��H�:uă�H�*��)�HŃ�����u H��1�[]A\A]�D�EH��� �پH� :H�81�苟��H��1�[]A\A]�ff.���E1�����@����~UD�E��fA��vRD9�|M�F9�u'�rf.�D�E��fA��v+D9�|&�F9�tMA��A��D)�L�҅�u1��D�H��H�<� �ѾH�V9H�81��Ԟ��1�H���DH���@���Lc�H��L9�rM����H��H9�s��H��Hc�1�H��詙��1�H���f�H�A��� H���������������f.���AWAVAUATL�gUSH��H�|$dH�%(H�D$x1��L�$$H��H���_�Wf���QH9��HH��L�=\;@A�L$�H��1�H��8M�l$���ĝ��A�$H��H��H����A�L$f������H9���L��L�t$f.���H�SA��L�������H�D$H��tI�x���@Ic�L�>��DL��7f��KH�8H��1��������H�D$PH��t�HH�8H��1����H�D$XH��t�HH��7H��1���͜��H�D$ H��t(H�T$(H��tH�HL�B�H��H��71�蛜��H�D$0H��t(H�T$8H��tH�HL�B�H��H��71��i���H�D$@H��t�HH��7H��1���F���H�D$HH��t�HH��7H��1���#����A�$L��%��H�H��H)�H�T�H��v�f��v��H9��g�����H�$%��I�H�D$L)��H�T�H��vA�$f��v H9�����H�D$xdH3%(�H�Ĉ[]A\A]A^A_��L�6�D���@L�E6�4���@L�6�$���@L��5����@L��5����@L��5��@L��5���@L��5����@L��5����@L��5���@L��5���@L�g5���@L�S5���@L�?5�t���@L���d����ϔ��ff.�@��H��(I��A�ɹ#dH�%(H��$1�H���H�A�8@�t$H��H�z�T$�H�$A�@D�L$��A�@A�@ �D$貔��H��$dH3%(uH��(��2���f�����fD��USH���o��x 1�H��[]�H��辒����H��ډ�������������f���ATUH��S����I��膒��H���څ�I�1��������uA�$1�������[]A\����������UH��SH��H��hdH�%(H�D$X1��[���1�H���H�H�gH��H������H�|$�����H��t%H�|$(t諙��H�|$(���E�K����E�H�T$XdH3%(uH��h[]�������ATI��USH��轖��� H����蝖����x2�Ń�t��t4I��[]A\�fD�H���+�����y�[�����]A\�D�H��������y���D��USH��dH�%(H�D$1��D$����H��H��t?H�l$�� H��H������H��H�߹��1�1�H��膒����x"H�L$dH3%(H��uH��[]��H��1�膖�����ϑ��ff.�@��AVA��AUA��ATI��UL��S����1�fD�pH��fD�h����H��H�߉C���H��L��H���3���H��[]A\A]A^����AWM��AVM��AUL�-) !ATI��UH��SH��H���t$�?����D$�,f�jHc�M��M��AU�L$H�ߋT$賗��ZY��~L��H��H��菕�����H��[]A\A]A^A_�ff.����ATI��USH���H��dH�%(H�D$1�贕��� H=����Γ��H�CH��� �����H�H�����H�{1�H�L$f�T$A���f�D$�|���L��H��H���i����UH�;H���k������������� H=�~T�uH�;I��L�\���H�S�����uOH�L$dH3%(u^H��[]A\�fD��Ɣ��H������fD�讔��H���f�H�;�8���H�{迍�������뙸������l���ff.����SH��H�?����H�{[醍��fD��S��H����H��H�dH�%(H�L$1�1�@�t$��f�L$H�L$D�D$A��8����P�SH�\$dH3%(uH��[��������OD�G��@���x������AUI��ATI��UH��SH��H���H�?�܍����xX�莓��� H=�~1H�U�sM��M��H�}���1҅�xMH����[]A\A]����F���H���H�=�1�����ߌ���H��[]��A\A]���fD�Ì���8H��� ���H��1�H��H��� H�81�虓���H��[]��A\A]������ATI��UH��SH���赒��� H=�~ H�S�sM��I��H�;[]A\�������~���H����f���AWI��AVI��AUA��ATL�%� UH�-� SL)�H���?���H��t1��L��L��D��A��H��H9�u�H��[]A\A]A^A_�ff.������H��H���Usage: %s [ OPTIONS ] OBJECT { COMMAND | help } %s [ -f[orce] ] -b[atch] filename where OBJECT := { dev | link | resource | system | statistic | help } OPTIONS := { -V[ersion] | -d[etails] | -j[son] | -p[retty] -r[aw]} -%c option requires an argument helpresourcesystemstatistic%s utility, iproute2-%s Unknown option. :Vhdrpjfb:versionjsonprettydetailsrawforcebatch>���h���h���h���h���h���h���h���h���h���h���h���h���h���h���h���h���h���h���h���h���h���h���h���h���h���h���h������h���h���h���h���h���h���h���h���h���h���h��� ���h�������h����h�������h�������h���h���h���h���h�������h�������6.2.0,-,No device name was supplied Unknown %s '%s'. errorWrong device name Wrong device name - %s Please provide device name. >drv_%s%s %d %s 0x%x %s %u %s %ld %s 0x%lx %s %lu No filter data was supplied to filter option %s There is filter option without data %s filter accepts "%s" characters only Unsupported filter option: %s Found key, but failed to allocate memory to store value This tool doesn't support switches yet Failed to open NETLINK_RDMA socket Failed to send to socket with err %d ����� ���������`��� adaptive-moderationparameterUsage: %s dev show [DEV] /var/run/netnsunknownUNKNOWN%s, %u: ifindex%s: ifnamenode_type %s node_typefw %s %04x:%04x:%04x:%04xnode_guid %s node_guidsys_image_guid %s sys_image_guidadaptive-moderation %s caps: <capsshowlistdev commandSG_GAPS_REGVIRTUAL_FUNCTIONRAW_SCATTER_FCSRDMA_NETDEV_OPA_VNICPCI_WRITE_END_PADDINGRESIZE_MAX_WRBAD_PKEY_CNTRBAD_QKEY_CNTRRAW_MULTIAUTO_PATH_MIGCHANGE_PHY_PORTCURR_QP_STATE_MODSHUTDOWN_PORTINIT_TYPEPORT_ACTIVE_EVENTSYS_IMAGE_GUIDRC_RNR_NAK_GENSRQ_RESIZEN_NOTIFY_CQLOCAL_DMA_LKEYMEM_WINDOWUD_IP_CSUMUD_TSOXRCMEM_MGT_EXTENSIONSBLOCK_MULTICAST_LOOPBACKMEM_WINDOW_TYPE_2AMEM_WINDOW_TYPE_2BRC_IP_CSUMRAW_IP_CSUMCROSS_CHANNELMANAGED_FLOW_STEERINGSIGNATURE_HANDOVERON_DEMAND_PAGINGcaswitchrouterrnicusnicusnic_udpunspecified %s dev set [DEV] name DEVNAME %s dev set [DEV] netns NSNAME %s dev set [DEV] adaptive-moderation [on|off] Cannot open network namespace "%s": %s Please provide device new name. UD_AV_PORT_ENFORCE_PORT_ENFORCEUsage: %s link delete NAME Unknown parameter %s netdevnetdev_index %u link %s/subnet_prefix %s subnet_prefixsm_lid %u sm_lidlmc %u lmcphysical_state %s physical_statenetdev %s netdev_indexadddeletelink commandSET_NODE_DESCEXT_INFOVIRTSWITCH_POR_STATE_TABLELINK_WIDTH_2XLINK_SPEED_HDRRESERVEDSMOPT_IPDAUTO_MIGRSL_MAPMKEY_NVRAMPKEY_NVRAMLED_INFOSM_DISABLEDPKEY_SW_EXT_PORT_TRAPCABLE_INFOEXTENDED_SPEEDSCAP_MASK2CMSNMP_TUNNELREINITDEVICE_MGMTVENDOR_CLASSDR_NOTICECAP_MASK_NOTICEBOOT_MGMTLINK_LATENCYCLIENT_REGOTHER_LOCAL_CHANGESLINK_SPPED_WIDTHVENDOR_SPECIFIC_MADSMULT_PKER_TRAPMULT_FDBHIERARCHY_INFONOPSLEEPPOLLINGARMEDLINK_UPLINK_ERROR_RECOVERPHY_TESTOPA_OFFLINEOPA_TESTDOWNACTIVEACTIVE_DEFERUsage: %s link show [DEV/PORT_INDEX] Usage: %s link add NAME type TYPE netdev NETDEV Please provide a link name to add. Please provide a link type name. Please provide a net device name. Usage: %s resource qpcm_idcqmrpdsrqDRIVER[%s]comm %s %s/%d%s/-link %s qp-type %s qp-typeresource commandSMIGSIUCUDRAW_IPV6RAW_ETHERTYPERAW_PACKETXRC_INIXRC_TGTpidsrqnpdncqnlqpnctxnrqpnsq-psnrq-psnpath-mig-statedev-typetransport-typesrc-addrsrc-portdst-addrdst-portcm-idnuserspoll-ctxmrlenmrn resource show [DEV] resource show [qp|cm_id|pd|mr|cq|ctx|srq] resource show qp link [DEV/PORT] resource show qp link [DEV/PORT] [FILTER-NAME FILTER-VALUE] resource show cm_id link [DEV/PORT] resource show cm_id link [DEV/PORT] [FILTER-NAME FILTER-VALUE] resource show cq link [DEV/PORT] resource show cq link [DEV/PORT] [FILTER-NAME FILTER-VALUE] resource show pd dev [DEV] resource show pd dev [DEV] [FILTER-NAME FILTER-VALUE] resource show mr dev [DEV] resource show mr dev [DEV] [FILTER-NAME FILTER-VALUE] resource show ctx dev [DEV] resource show ctx dev [DEV] [FILTER-NAME FILTER-VALUE] resource show srq dev [DEV] resource show srq dev [DEV] [FILTER-NAME FILTER-VALUE] local_dma_lkeyunsafe_global_rkeyiovaDIRECTcqepoll-ctx %s SOFTIRQUNBOUND_WORKQUEUE%s:%u %s:IPoIBTCPUDP---ps %s IDLEADDR_QUERYADDR_RESOLVEDROUTE_QUERYROUTE_RESOLVEDDISCONNECTADDR_BOUNDLISTENDEVICE_REMOVALDESTROYINGMIGRATEDrqpn %d rq-psn %d path-mig-state %s RESETRTRRTSSQDSQEERRREARMnetns %s copy-on-fork %s copy-on-forkexclusivesharedsystem commandUsage: %s system show [ netns ] %s system set netns { shared | exclusive } Usage: %s system set [PARAM] value system set netns { shared | exclusive } valid options are: { shared | exclusive } supportedmodeunbindauto %s statistic show where OBJECT: = { qp } CRITERIA : = { type } Examples: %s statistic qp show %s statistic qp mode %s statistic mode supported optional-counterscntnUnknown auto mode '%s'. Unknown parameter '%s'. on offmode %s cntn %u LQPN: <unsetstatistic commandUsage: %s [ OPTIONS ] statistic { COMMAND | help } %s statistic OBJECT show %s statistic OBJECT show link [ DEV/PORT_INDEX ] [ FILTER-NAME FILTER-VALUE ] %s statistic OBJECT mode %s statistic OBJECT set COUNTER_SCOPE [DEV/PORT_INDEX] auto {CRITERIA | off} %s statistic OBJECT bind COUNTER_SCOPE [DEV/PORT_INDEX] [OBJECT-ID] [COUNTER-ID] %s statistic OBJECT unbind COUNTER_SCOPE [DEV/PORT_INDEX] [COUNTER-ID] %s statistic show link [ DEV/PORT_INDEX ] %s statistic mode [ supported ] %s statistic mode [ supported ] link [ DEV/PORT_INDEX ] %s statistic set link [ DEV/PORT_INDEX ] optional-counters [ OPTIONAL-COUNTERS ] %s statistic unset link [ DEV/PORT_INDEX ] optional-counters COUNTER_SCOPE: = { link | dev } FILTER_NAME: = { cntn | lqpn | pid } %s statistic qp show link mlx5_2/1 %s statistic qp mode link mlx5_0 %s statistic qp set link mlx5_2/1 auto type on %s statistic qp set link mlx5_2/1 auto off %s statistic qp bind link mlx5_2/1 lqpn 178 %s statistic qp bind link mlx5_2/1 lqpn 178 cntn 4 %s statistic qp unbind link mlx5_2/1 cntn 4 %s statistic qp unbind link mlx5_2/1 cntn 4 lqpn 178 %s statistic show link mlx5_2/1 %s statistic mode link mlx5_2/1 %s statistic mode supported %s statistic mode supported link mlx5_2/1 %s statistic set link mlx5_2/1 optional-counters cc_rx_ce_pkts,cc_rx_cnp_pkts %s statistic unset link mlx5_2/1 optional-counters The parameter %s shouldn't include range BASIC%s%d%s%d-%dTM/sys/class/net/%s/%sfopen %s: %s strtol %s: %sFailed to parse %s msecmsecsdefaultallanyCannot find device "%s" HZPROC_NET_PSCHEDPROC_ROOT%s/net/psched%*08x%*08x%08x%08x???inetinet6mplsbridgeany valid%x%s\%03o%Y-%m-%dT%H:%M:%S[%s.%06ld] Timestamp: %s %ld usec NONElink_index%s@%sMissing continuation line Out of memory \ Unterminated quoted string Timestamp: %s %lu us usecusecs%.3gs%.3gms%uusnsecnsecs%.3gus%lldnsCommand failed %s:%d "%s", not "%s" [%d]could not build pathname for property property "%s" in file %s is currently unknown value "%s" in file %s is not a number Error: an IP address is expected rather than "%s" Command line is not complete. Try option "help" Error: argument "%s" is required Error: argument "%s" is wrong: %s Error: duplicate "%s": "%s" is the second value. Error: either "%s" is duplicate, or "%s" is a garbage. BUG: device with ifindex %d has nil ifname Error: %s address is expected rather than "%s". Error: "%s" may be inet prefix, but it is not allowed in this context. Error: %s prefix is expected rather than "%s". Too many arguments to command Cannot open file "%s" for reading: %s Error: argument of "%s" must be one of �2���2���2���2���2���2���2���2���2���2���2���2���2���2���2���2���2���2���2���2���2���2���2���2���2���2���2���2���2�� �@�@��.Ae��A/proc/net/psched 0x%x %s 0x%x %s #%d %s %d %s #/etc/iproute2/rt_protos/etc/iproute2/rt_protos.d.conf/etc/iproute2/rt_protos.d/%s/etc/iproute2/rt_tables/etc/iproute2/rt_tables.d/etc/iproute2/rt_tables.d/%s/etc/iproute2/rt_scopes/etc/iproute2/rt_realms/etc/iproute2/rt_dsfield0x%02x/etc/iproute2/group/etc/iproute2/nl_protosrtnlunusedusersocktcpdiagnflogxfrmselinuxiscsiauditfiblookupconnectornftip6fwdec-rtueventgenlscsi-transecryptfsrdmacryptolocalmainglobalsitehostnowhereunspecredirectkernelbootstaticgatedmrtzebrabirddnroutedxorpntkdhcpkeepalivedbabelbgpisisospfripeigrpDatabase %s is corrupted at %s /etc/iproute2/protodown_reasons.d/etc/iproute2/protodown_reasons.d/%sif%u*Cannot send dump requestDump terminated :%02x"%s" is invalid lladdr. %xjson object%s %%u%s %%struefalse%#llx%llu%.0f%s%sbitCOLORFGBG-coloralwaysnever[0m[31m[32m[33m[34m[35m[36m[37m[1;31m[1;32m[1;33m[1;34m[1;35m[1;36m[1;37m /proc/mounts%*s %4095s %127s %*s %*d %*d strdup failed copying pathmkdir failed for %s: %s Failed to find cgroup2 mount /var/run/cgroup2noneFailed to mount cgroup2: %s Invalid cgroup2 path Failed to open cgroup2 mount Failed to get cgroup2 ID: %s Invalid size of cgroup2 ID Invalid cgroup2 ID Failed to open cgroup2 by ID /proc/self/fd/%d/proc/%s/statusName:/proc/%d/commFailed to open mounts file: %s Failed to allocate memory for cgroup2 path Failed to setup cgroup2 directory Failed to mount cgroup2. Are CGROUPS enabled in your kernel? Failed to read value of symbolic link %s Error: too many labels. json_writer.cself->depth > 0\t\n\r\f\b\\\"self->depth == 0null%g%hhu%hu%lu%lx%ldjsonw_endjsonw_destroyErrorWarningInvalid extack attribute EOF on netlink Cannot talk to rtnetlinksender address length == %d Truncated message !!!malformed message: len=%d ERROR truncated RTNETLINK answers: %s Unexpected reply!!! Message truncated !!!Remnant of size %d DONE truncated RTNETLINK answersCannot open netlink socketSO_SNDBUFSO_RCVBUFCannot bind netlink socketCannot getsocknameWrong address length %d Wrong address family %d NETLINK_LISTEN_ALL_NSIDSender address length == %d rtnl_from_file: fread!!!Deficit %d, rta_len=%d U8U16U32U64FLAGNESTEDNESTED_ARRAYNUL_STRINGBINARYS8S16S32S64BITFIELD32 policy[%u]:attr[%u]: type=%s policy:%u maxattr:%u range:[%lld,%lld] range:[%llu,%llu] min len:%u max len:%uextack attribute %d failed validation netlink receive error %s (%d) malloc error: not enough buffer Invalid offset for NLMSGERR_ATTR_OFFS Error: Buffer too small for object. Dump was interrupted and may be inconsistent. rtnl-from_file: truncated message !!!malformed message: len=%d @%lu addattr_l ERROR: message exceeded bound of %d addraw_l ERROR: message exceeded bound of %d rta_addattr32: Error! max allowed bound %d exceeded rta_addattr_l: Error! max allowed bound %d exceeded �����P�����������������������p��`��P��@��0�� �� Failed to send datakernel answers: %s ;��|Q��$LZ��Lc���<f��,g��d\g��|\h���|h����h���h��<�h��Pi��dli����i����i����i���,j���Lm��H�n���p���lp���q��@lr���,s����s��X\t����t���<v���|v��,w��\Ly���,z���lz����z���z��,l{��\�������\��������L���\���0܁��\��p�����l����|�������������l����������������������,�������(l���L<���p�������\���$,���D,���`|������������,����l�������0��P,���pl���������|����\���@L���tl���������������������� \���L��p�����̠��������ܡ������<|���Pܣ��|,����L�������̧��|���Pܩ�����������0�����L����\��� ���d ����� L���� ̼��4!����h!����!���",��D"���"����"���"l���"���#,��$#��@#��l#����#L���#����#����#���#,��$���4$L��P$���l$l���$����$����$,���$L���$l��%���%���,%���@%���T%��h%,��|%L���%l���%<���%���&,�� &���p&����&����&����&���'���('���L'l�p'���'���'\��',�(l� (,�L(l�|(���(l��(��,)�x)���)���)<�<*�����*,����*\����*,���0+���d+<����+���,����8,����,\ ���,���,l��D- ��X-l ���-����-���-��� .���4.���`.����.����.����.���/L��,/���X/����/L���/����/���0\��40��p0L���0����0����0���01<��H1���l1���1L���1����1����1 ���1L ��2| ��02� ��D2� ��|2<!���2�!���2�!���2l"��,3�"��X3�$���3�$���3�%���3�%���3\&���3�&���3'��4�'��D4<*���4\*���4�*��5,��T5|,���5L-���5�-��@6�.��l6|0���6|2��7�3��\7,4���7\4���7,5���7\5���7�7��(8<8��t8�8���8\9���8;��9�;��<9�=��p9�>���9\@���9|A��4:�A��L:�B���:�B���:C���:lC���:�C��;D�� ;<D��H;|D��t;�D���;�D���;�D���;E���;LE���;�E���;LF��L<�G���<�H���<�I��4=�J���=L���=\M��$>�M��d>O���>�O���>,Q��H?�Q���?<S���?�S��@�T��h@lU���@�U���@,W��AlX��hA,Y���AZ���A\[�� BL\��tB|]���B�]���B^��CL^��CL_��`C�_���Clb���C�c��0D�c��HD�d��tD�d���D<e���Df���D�f���Dg��Ei���E�j���ELk�� F\k��4F�k��LF�k��`F�k��tF�k���F�l���F�l��G�l�� Gm��@G�m���Gn���G�n�� HLo���H�o���H�p��@I,q���I�q��Jlr��`Js���J�s��K<t��PK�t���K|u���K�u��L�u��L�v��`L�w���L\x��M�x��M�x��,MLz��|M{���M�|���M~��N<~��N\~��,Nl��lN�����N����N\���,O�����O�����O܈��Pl���P̉��dPl����PL���,Q\���lQ�����Q����Q\���R����0R���`R<���|R�����R�����R<����R,���S<���0S|���LS����lS����SL����S|����S�����S�����Sܒ��T����T���,T<���@T\���TTl���hT����|T�����T̓���T�����T,����T\���U����<U����dU���U����UL����U|���V����,Vܕ��TV���|V,����V�����V����Vܗ��<W�����Wl����Wܚ��,X<���|X���Xl����Xܤ��Y���,Y<���HY,���|Y<����Y�����Y�����Y|���Z��0Z����\Z,���xZ̫���Z<����Z�����Z,����Zܭ��$[|���@[����T[\����[����[ܰ���[�����[���\���8\��T\L���p\̴���\,����\�����\̵���\���]����0]\����]�����]����^���� ^̼��8^����P^,���h^̽���^�����^L����^�� _���<_,���P_|����_�����_,����_����_����`,���`\���0`����L`����``����`����`L���`����`���@a��\a,��pal���a����a\���a���,b���Xb����b|���b���c��8c|��\c���pc����c����c\��DdzRx�(W��/D$4PB���FJw�?:*3$"\�J���t�W��0Hg��W���G�� A��X��L�XS��'F�N�E �B(�A0�C8�J�� 8A0A(B BBBAxX�� ( tX��ZF�I�A �DCBL�X��`�X��4t�X��BF�A�D �b ABHAFB��X����X����X��3N]��X��Kg�[F�L,Y��F�B�B �B(�A0�A8�D� 8A0A(B BBBEHX�[��gF�B�E �B(�E0�A8�D`� 8A0A(B BBBD<� ]��NF�E�E �A(�A0�� (A BBBI4�0^��ZF�I�A �t FBDAFB0X^��,F�P�F �G�� AABH<PT_���O�B�B �A(�A0��(A BBBC�����\��_���F�B�B �B(�A0�A8�D@c 8C0A(B BBBGa8F0A(B BBBt�D`���F�B�B �B(�A0�A8�D@a 8A0A(B BBBCH 8A0A(B BBBFd8C0A(B BBB4h�`��QF�E�F �D(�K0j(A ABB4��`���E�A�L h CABi CAA,�,a��;E�C D��E�E�D�� H0<b��:E�C�G M AABDPA,<Hb���F�A�A �\ ABIHl�b��,F�B�B �E(�D0�D8�DPg 8A0A(B BBBD8��d���F�B�D �D(�D@M (A ABBI�@e��;Tfhe��,H_$�e��,H_,<�e���R�A�A �n�H�G�Llf���F�B�B �B(�A0�A8�D�� 8A0A(B BBBD�hi���Hp� A��i���H`| A�pj��ZH@L A�j���E�~,(k��(@$k��zA�M�G0] AAAlxk���tk��(�pk��lE�A�G@� AAJ��l�� ��l��~E�Q a AA �m���E�G z AIt�m���F�J�B �B(�A0�F8�G�E�K�F�T�N�H�K�F�T�N�Q 8A0A(B BBBH��p���H�� A�pq��fH@F B��q��fE�`�r�� r�� r���E�Q r AA 8 �r���E�G a AB \ s���E�KP� AG � �s���E�KP� AD(� pt���E�A�G0� AAJ`� $u��gF�J�B �B(�A0�F8�L���K�F�T�N�� 8A0A(B BBBG4 0y���K�� AT �y���H�,p �{��ME�I�G� AAH� �|��(E�O DK� �|��<E�T GW� }��<E�T GW4}��<E�T GW T}��<E�T GW@t}��<E�T GW`�}��>E�T GY��}��>E�T GY��}��8A�fL��}���F�J�G �B(�A0�A8�G�� 8A0A(B BBBA@x���F�J�E �D(�D0�G@y 0A(A BBBK0P����F�D�C �G0s AABE�Ѐ�� �܀���E�G r AA �H����E�G r AA ������E�G r AA( ����E�D�D0} AAA(0 �����E�D�D0} AAA \ ����E�G r AA(� t����E�D�D0} AAA� ��8 � ����E�D0o AG� ����DE�gH��=F�N�L �E(�N�q�H�]�A�\ (A ABBDL��Q(`$���QJ�J�S IN�K��X���AJ�e������������Hp� AL�����B�B�B �B(�A0�D8�D�� 8A0A(B BBBI0,�����F�I�F �G�| AABDP`$���YF�J�G �B(�A0�A8�G� 8A0A(B BBBAL�0���B�B�B �B(�A0�A8�G�� 8A0A(B BBBF8���F�J�A �A(�L�� (A ABBKP@Ԏ���F�J�B �B(�F0�A8�G�h 8A0A(B BBBDL�0����B�B�B �B(�A0�A8�G� 8A0A(B BBBE8�p���F�J�A �A(�L�� (A ABBKP D����F�J�B �B(�F0�A8�G�h 8A0A(B BBBD4t����uB�D�D �w AMA\FBD����B�Q�D �I(�LpWxA�IxDp_ (A ABBAL�`���B�E�B �B(�A0�D8�J�9 8A0A(B BBBC0D�����F�I�F �G�� AABFPx,���|F�J�G �B(�A0�A8�G�= 8A0A(B BBBGH�X����B�E�E �B(�D0�C8�J�G 8A0A(B BBBH8ܡ��2F�J�A �A(�L�� (A ABBALT���F�J�B �B(�F0�A8�G�] 8A0A(B BBBG������H`u A��kHP] A�H���HE�B�|���JHA ����mE�Q P AA4����K�� D(PԦ��E�A�G0� AAB|�����Hp� A�(����H`u A������H`u A�����H�� A������H`u A���K�� A(����H`u AD�����H`u A`��H`u A|h����HP^ J�ܬ���H`u A�P����H`u A�ĭ���Hp� A�H���T���`���(l���<x���P����d����x��������������0������B�N�C �G0� AABA(�\����A�M�G0� AAA��?E�9L0���\F�J�G �B(�A0�A8�G� 8A0A(B BBBH����AA�{L�H����B�J�B �B(�A0�A8�G�� 8A0A(B BBBG������ ��E�G r AA 8\���nE�D k AK \����nE�D k AK ��nE�D k AK �@����E�D o AG ����E�D k AK �x����E�D o AG$���<E�T GW(0D����A�D�G0p AAB,\ػ��:E�C D��H�M�� G ���GE�G0H AKH�����F�B�B �B(�A0�A8�GPY 8A0A(B BBBH<�x���B�B�E �A(�D0�E (D BBBCH<X����F�J�B �G(�A0�A8�G� � 8A0A(B BBBB �����E�G0� AEL�H���F�J�B �G(�A0�A8�G�+ 8A0A(B BBBIL����\F�B�E �H(�D0�A8�G� 8A0A(B BBBGLL����F�J�G �B(�A0�A8�G�5 8A0A(B BBBA0�h��,F�I�A �L�� AABJ �d��"K� AH�p���B�E�E �D(�D0�} (C BBBF\(A DBB0@����F�I�F �G�| AABDLtp��YF�J�G �B(�A0�A8�G� 8A0A(B BBBAL�����B�B�B �B(�A0�A8�D�E 8A0A(B BBBC0����F�I�F �G�| AABDPHL��YF�J�G �B(�A0�A8�G� 8A0A(B BBBA,�X��o A�C B�E�O���� B0�����F�I�F �G�| AABDP��YF�J�G �B(�A0�A8�G� 8A0A(B BBBAT ���0h���QA�A�D w FADDCAP����EF�Q�J �D(�A0�G�\�A�N�A�� 0A(A BBBE���F(��E�A�D0q AAC0��9(D���E�A�D0f AAF@p$�bF�E�E �I(�D0�DP� 0A(A BBBA0�P��F�A�A �D0a AABG��� ���( ���E�A�D0e AAG(< ��E�A�D0d AAH8h |��F�E�A �D(�G@v (A ABBE0� ���F�D�D �G0u AABB � |�]E�G J AA � ��ME�G z AA !��QE�G ~ AA8D! ��F�E�D �A(�FP� (A ABBA�!��$8�!���F�B�E �D(�JP� (A ABBE0�!4��B�F�D �G�z AABG8"���F�E�I �G(�D@Q (A ABBJ@"d��HR X"���E�R�} AA|"X�4EAU�"|�4EAP�"��7EAK�"��7EAK�"��7EAK#�2Hi #4�/E�W LF@#D�4T#P�?F�G�D �N ABFSAB�#X�]E�` K�#��B0�#��KE�D�Q T CAFDIAH�#���F�E�I �E(�F0L (D ABBDD(G DBB(<$8��E�A�G�c AAF(h$���E�H�G�^ AAD�$0�HN�$8��$���$���$|�J(�$��`E�D�F M CAA((%��E�D�D T CAAdT%P�F�E�B �E(�D0�D8�Fp� 8O0A(B BBBE8 8A0A(B BBBF�%����D�%�����F�B�B �B(�A0�A8�DPs8A0A(B BBBH&���F�B�B �E(�A0�C8�G�� 8A0A(B BBBA8d&����jM�F�D �x FBIACBA���X�&���F�E�N �B(�D0�D8�FPSXN`qXAPIXe`P8F0A(B BBBP�&X����O�B�I �B(�D0�D8�J@Z 8A0A(B BBBFP������(P'�����E�F�D`� AAGP|'h����F�B�E �A(�D0�F�� 0A(A BBBEW�J�_�A�L�'�����F�E�B �B(�A0�D8�D�g 8A0A(B BBBGH (d���F�E�B �B(�A0�A8�D@� 8C0A(B BBBA0l(8����F�A�D �D0k AABA�(����-E�g8�(�����F�B�G �D(�D@� (A ABBA�(<���.()X���eE�J�J�� AADH8)����eF�H�D �A(�G0Q (D ABBDc(D ABBH�)����aF�E�D �D(�D0Y (D ABBGW(D ABB �)���E�D m AI0�)p���F�D�D �G@P AABG (*����K�I Di G0L*x��F�D�D �G@P AABG �*d���I�T CYP�*���F�B�B �B(�A0�A8�G� I� 7 8A0A(B BBBAH�*l�� F�B�E �E(�A0�A8�DP� 8D0A(B BBBKD+@��&H]H\+X���F�B�E �B(�A0�A8�Dp� 8A0A(B BBBG�+���$4�+��`J�A�G l FAKGAAA���+0��B,l��B,���B$0,���,E�C�F YCA(X,���:F�F�D �_ ABA�, ��&H]�, �� �, ��1�,@ ���,L ��'�,h ��~L�e GEL-� ���F�E�B �D(�A0�w (A BFFHN(A DBEH\-� ��IB�L�E �E(�D0�A8�G�� 8A0A(B BBBDH�-� ���B�J�L �E(�A0�A8�G�� 8A0A(B BBBDL�-���)B�B�B �B(�A0�A8�G� I� � 8A0A(B BBBALD.���B�B�B �B(�A0�A8�G� I� � 8A0A(B BBBAH�.` ��B�G�E �L(�A0�A8�G�� 8A0A(B BBBDP�.4��DB�B�B �B(�A0�A8�G� I� 8A0A(B BBBA<4/0���F�A�A �G0m AABHP DABHt/���F�E�E �B(�A0�A8�DP� 8A0A(B BBBHH�/d���F�E�A �D(�F@l (A ABBH^(D ABBH0���GF�E�E �B(�A0�A8�DP� 8A0A(B BBBHHX0����F�E�A �D(�F@l (A ABBH^(D ABBH�0P��GF�E�E �B(�A0�A8�DP� 8A0A(B BBBH8�0T���F�J�D �X ABAN EBKH,1���F�E�B �B(�D0�A8�DP� 8A0A(B BBBC,x1���cM�H�G N AADp��4�1���oF�N�F �~ ABEKABH�1��JF�E�E �B(�A0�A8�DP� 8A0A(B BBBHH,2��1F�E�B �B(�D0�A8�DP� 8A0A(B BBBC(x2����F�J�D �~ ABK<�2����E�G�F0v AAFd DAGRDAH�20��GF�E�E �B(�A0�A8�DP� 8A0A(B BBBHP034���F�A�A �D0X CABFt CABFf CABDL�3���!F�E�E �B(�A0�A8�DP� 8A0A(B BBBK�3���L$�3���AA�D�D uAA4��)H$40���B�B�H �E(�A0�D8�D@� 8D0A(B BBBF<p4����R�B�E �A(�D0n(A ABBF����L�4D��xF�B�B �B(�A0�A8�G�' 8A0A(B BBBA<5t��-B�N�A �C(�G� (A ABBA@5d��;Hr(X5����F�A�A �} ABH�5 ��N�5\ ��N0�5� ���F�A�A �F0t AABJ�5D!��b�5�!���Q�p A�6"���F�B�B �E(�A0�A8�DPi 8J0F(B BBBJ� 8A0A(B BBBCj 8A0A(B BBBLL 8J0F(B BBBLY 8J0F(B BBBOH�6d#���F�B�B �H(�A0�D8�N�c 8A0A(B BBBF 7�$��tP�h HY �E07$%��D7 %��1TP\7H%��p7D%��!�7`%��`�7\%���B�E�E �E(�D0�C8�G@j 8C0A(B BBBKe 8C0A(B BBBO�7�%��8�%��:E�h KA08�%��0HM KK<P8�%��zE�D�F m AAJR AADDIH<�8&��jE�D�F ` AAGK AAKDIH\�8D&���F�E�E �D(�D0�h (C BBBGV (G EEDEI(C BBB\09�&���F�E�E �D(�D0�h (C BBBGV (G EEDEI(C BBB\�9�&���F�E�E �D(�C0�j (C BBBF\ (D BEDEH(C BBB\�9'���F�E�E �D(�C0�j (C BBBF\ (D BEDEH(C BBB\P:D'���F�E�E �D(�D0�h (C BBBGV (G EEDEI(C BBB\�:�'���F�E�E �D(�D0�h (C BBBGV (G EEDEI(C BBB\;�'���F�E�E �D(�D0�h (C BBBGV (G EEDEI(C BBB\p;(���F�E�E �D(�D0�h (C BBBGV (G EEDEI(C BBBX�;D(���F�E�D �D(�F@r (C ABBEh (F ABBEI(C ABB0,<�(��|F�N�P �GpG AABAl`<�(���F�E�E �D(�D0�t (C BBBKV (G EEDEI (C BBBFL(C BBB0�<4)��|F�N�P �GpG AABA=�)��"=�)��"@,=�)���F�E�E �D(�D0�F�C 0A(A BBBG@p=d*���F�E�E �D(�D0�F�C 0A(A BBBG\�= +���F�E�E �D(�D0�e (C BBBJV (G EEDEF(C BBB>P+��((>l+��-L<>�+���F�B�L �E(�D0�C8�G` 8A0A(B BBBD�>�,���Xe Ci(�>h-���E�C I���2 E4�>�.��jF�D�D �G�# AABD?0��$? 0��<<?(0��B�B�A �A(�G� L�!� (A ABBA8|?�0��F�E�A �A(�D0� (C ABBD4�?�1���E�C�D Q DAF� DAHH�?43��3F�F�B �B(�A0�A8�Dp� 8A0A(B BBBEP<@(5��ZF�B�B �B(�A0�A8�G� I�! 8A0A(B BBBEH�@47��;F�B�B �A(�A0�G� L�! 0A(A BBBA4�@(8���F�A�A �G� I� � AABKA�8���H(AL9��^F�E�D �D(�F0T (C ABBKJ(G DBBLtA`9���F�E�D �C(�G0U (A ABBDJ (C ABBFt�A�9���F�B�E �B(�D0�D8�F@W 8C0A(B BBBHo 8C0A(B BBBED8D0A(B BBB<<B:��F�I�D �D(�G@� (A ABBFL|B�:��^F�E�D �D(�F0T (C ABBKJ(G DBB(�B�:��BA�C�G c AAH(�B;��KB�A�D �@AB$C@;��%AA^,@CT;��sB�H�D �� FBGpC�<��)E�c(�C�<��bE�A�D v AAA�C�<�� 0�C�<��{E�D�G A AAEWFA(DD=���E�D�J�� AAH,D>��@D>��>E�s A\D(>��.E�T GI|D8>��TE�r I(�D|>��:E�D�G Q GAG�D�>��'�D�>���D�>��E�>��E�>��(E�>��<E�>��PE�>��dE?��xE�>���E?���E?��$�E ?��&E�D�G IGA$�E(?��%E�D�F IGAF0?��*E�G UD$$F@?��$E�C�G IFA$LFH?��&E�D�G IGA$tFP?��&E�D�G IGA$�FX?��%E�D�F IGA$�F`?��%E�D�F IGA$�Fh?��&E�D�G IGA$Gp?��&E�D�G IGA$<Gx?��$E�C�G IFA$dG�?��&E�D�G IGA�G�?��E�L$�G�?��pA�R�S ~FA�G�?��sD@i AX�G4@���F�B�I �A(�G0v (F ABBFd (F ABBAd(F ABBLLH�@���B�E�E �D(�A0�] (A BDBIE (C BBBA`�HA���B�B�B �J(�D0�D8�DP\ 8A0A(B BBBFT 8A0A(B BBBA8ItA��nF�F�A �D(�G�z (A ABBHL<I�B��SB�F�B �J(�D0�F8�G�< 8A0A(B BBBE �I�F���E�Q`p AIL�IDG��xB�F�E �B(�D0�A8�G�� 8A0A(B BBBI JtK��cE�W @ AA$J�K��-H d<J�K��#Q�Q0XJ�K���F�M�A �G@; AABF�J�M��(�J�M���E�F�J�� AAA(�J8N���E�F�J�� AAA(�J�N���E�F�J�� AAA$K`O��oH@a A(@K�O���E�A�J�� AAAlKXP��oH@a A(�K�P���E�F�J�� AAA�K Q��oH0a A�KtQ��wH0i A�K�Q��oH0a A(L,R���E�F�J�� AAA4L�R���H@r FPL4S��(dL@S���E�A�J�� AAE(�L�S���E�I�J�� AAA(�LhT���E�I�J�� AAA�L�T��HP(MU��E�I�G�� AAF,M�U���K�� AHM�V���Hp� AdM�W��`HpR A�M�W��yHpk A�M8X��SH0E A0�M|X���F�D�D �D0k AABA�M�X��N�X��PH0B A NY��xE�W B AAT@NdY���F�B�B �B(�A0�A8�H��Q G�U 8A0A(B BBBCT�N�\���F�B�B �B(�A0�A8�H��Q DЀ� 8A0A(B BBBD(�N^���E�E�J k AAGOx^��0Ot^��!H XHO�^��"H Y`O�^��!H X(xO�^���E�F�J�~ AAA�O0_��"H Y4�OH_��AF�E�D �G(�G0I(G KBB8�O`_���F�B�A �D(�J0U (A ABBF0P�_��G�WLP�_��4`P�_��CF�E�D �D(�D0b(D ABB�P�_��4G�l�P`��mDh(�Ph`���E�E�J AAK�P�`��!H XQ�`��"H Y(Qa��"H Y@Q$a��)E�c\Q8a��HpQDa���F�E�D �I(�M0� (C ABBAh(C ABB�Q�a���Q�a���me�Qlb��fiTLR�b���F�B�B �B(�E0�A8�G�� 8A0A(B BBBIPRDf���K�} AlR�f�� (�R�f��>E�A�D M AAA(�R�f��OF�A�D �v ABD(�R�f���E�D�G�� AAA4S`g��{F�D�A �s ABGR FBF(<S�g���E�A�D0{ AAI8hS,h��YF�E�E �D(�D0�y(A BBBP�SPh���F�E�E �I(�D0�D8�GPZXK`QXAPZ8A0A(B BBB0�S�h��dF�D�A �L0� AABG,T�i��E�P HT�i��iE�L Q AAlTj��X�T$j���F�E�D �D(�G0E (C ABBIg (A ADBIu(A ADB,�T�j��WF�D�D �k ABLDU�j��eF�E�E �E(�H0�H8�G@n8A0A(B BBBTUk���ZpZ�]"��V9�h��j��p��d��r��f��b��������������$�.�<���L�^�l�v�����������������������,�?�J�V�d�z������������������������������������5���� �+�6�?���K�a�l�|�������������������������+�:�C�R�V�\�B�d�j�r�����������R�����d������������"���0�;�C���K�O���T�X�\���K�a�b�\�f�K�k�r���y���T�b�\�����������K�����������������K�X�a�����t���K���T�����K�a�T�a�����������������#� �+�6�=�L���������������W���d�������\�K�����K������� ��������)�E�)�_�e�k�q�w�}�����������������Z�Vbn(�D ���]"�]"���o0�x H@�" �7� ���o���oh���o�o0���o&�" E0E@EPE`EpE�E�E�E�E�E�E�E�EFF F0F@FPF`FpF�F�F�F�F�F�F�F�FGG G0G@GPG`GpG�G�G�G�G�G�G�G�GHH H0H@HPH`HpH�H�H�H�H�H�H�H�HII I0I@IPI`IpI�I�I�I�I�I�I�I�IJJ J0J@JPJ`JpJ�J�J�J�J�J�J�J�JKK K0K@KPK`KpK�K�K�K�K�K�K�K�KLL L0L@LPL`LpL�L�L�L�L�L�L�L�LMM M0M@MPM`MpM�M�M�M�M�M�M�����i�'�/�5�:�B�H�N�X�b�f�l�s�z�������� �"`�����"`�"@�"����`�������b���������������������������� � ���#�'�,�1�5��������GA$3a1�D�YGA$3p1113�Vw�GA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GOW*�GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA*�V��GA$3a1Z�GA$3p1113\��GA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA*GOW*�\��GA*\y�GA*��GA*Qw�GA*GOW*���� GA*FORTIFY\w�GA+GLIBCXX_ASSERTIONS GA*FORTIFY�Z��GA+GLIBCXX_ASSERTIONSrdma-6.2.0-6.el8_10.x86_64.debug�s�c�7zXZ�ִF!t/��Wg�]?�E�h=��ڊ�2N�aD> ���`���,:�Y��Ӽ����*$�����K쉿26�ĺ�3Յ�Dݗ@m�h��.�G�}05d����(G4�B�!���FZb��w�_;�GBv�5:�m1�_�.�fʂ�����Fi��#�G^b�(�NfƳ��,F�ei�=:�sw�9�t���/LDx ��-F�m&����9�9��eO��GVS\��b2ފ[�|L�D��]ma����ǚ]7�^8`���M�<88�f�Ӻ�Q����m�7����:���h���Ro� �X�h�� ���C�����Z�DtA���� C0�D*E�\�1or�v�:W(���7�R��,&}�B��F=���x�#9��'zui�ڊ���BB9�°���}�&��$rI��kd<Z:��?�5�ӳi��$��6/��wy� ���m��Ur.�Y���#&��gV��A᧒�@�� /��L��I�����mS�jGHYy���T��K������ "?e����v��0����!��ufO?��6�� x6~�µj\�c��t�G�j�lW�@��d>tz��8^����eܖoq���:�����S<�AH��AsYƸD����zhB�R+�B�;�q��P�H˴�g_fx�!�2�Ih}6Yf��վ���.S��ZҚh,����.���?�%=�V��57��mW��U���8�ޖi/@?�e�.�?�̾���x)7�.�}��=�����5 +i�,�`4;�x�H�(�H/�e^����e��`��<���T:��sp��DO�j��5�SG����<�?3������2_Y")3ۊ��f��X��N�ɻ�f,���iŹ�[P���f���Q��Jmi�:�6%\U��w�K�-!�<�Wù0�Z�Qg���r��ʣ��b#��2귓-.C*���.c���N&���I�g#�⋷O��w� �\P��O�A��@x�����ה�>' |�D��6lAk�= �ꭉ�VI�T�A:����GH�W�݈�֭k[^N�NI����%l��5����&o=�F)�rla��eY�tp���s��NP4%��˛��� L���G@ W�b�� ��Hq;��9@����X�WR ��!�"qԤ�j���X��[�M�@�Y#�c�)vW�DU�ѯ)���jqHW��k�X��2JX����fѰVC�^Na�_�����2cU�ع��`!�qխ�8i��}������&��".�8R�P��eV�OF��38�.���V�r��j>���j��"}C���[����jFw��g�&��(�,�p��t�ߜo�?$(EUH��;@.�*�u�r��#��y��O�u���5�V+�l����G����d2�h\g�%Z�z�Z_l�y�1��T����ˢ�i'���L����x3�%�}}\�����JU��f�>~�$�o�vO��knH�Y{�2��Q��O����7�� x��E��!�<��,|�� ���S�����0|B�S\P��H��ȧ8�YKG�V��^KU�?�!�Z>�ƻ��+�<����3;I�h8�}|<�,�a����*�e����%������oc�ǍZ�T���w���AX9Ԉ��MG�Ư�P����o ��b�p�k}(κ���A!�u+�ħ��{���M.���d[Ev���I������ǽŞ]DUAE7`F�zͧ�H�0�>O}��+r ��<�?5)���Ipb��j�O�"�0H�hou�/�.8���5�CAػM6fX�dpJ�l��)�ă�.c�H�� [�[U�5�ʂ���i������_�'Y�٫���d jĎv��/�Fl�:a��a�0Ο�T�0���������r��e�� 3�j\Qo+J� ����;����.�좲Ľ��{Vj�&Y�ñX���xQ5t2J8}����B�m��m��/�׳@�I�����WP�B������X�&Ej��0U�7�jqBU1T�Ņ��]s���������DCG�h�Ԅ�[>��K@�SOϏǪ�HWW �b�ɳ֮�����M7&-c�Ct!4�u�)*�X�h��$C�L���bj,<�85�H����H)?�T�t6��~��(:�����t�(Z�pY�6��}OV�t&2�G��5:I����g@���+��x�_��f ��e��p��KJ}��5�/���㠦D��^|e��=�T���)ϵ�@�8�������tUA&N��vrOkG[Pu�sWs�b����:�9)�9e"�Mz�ʯ��#�!�ޑ��)5�-����ڵ}z$�!�&p��X�!�hgi�+ �ݱ�Щ��6�sn�Q�;��Ϭ�Q�pd�g���G�+��B���m��WA%�N엲���K��D�ֹ�Cu�`[��2פN�Y���</�6l:hz��0}����nq�~͏J���l�eƎ�V������yh�Ι��e������~��6�m��6��K���j͞���:��<�px�S���Zp�U��;:v��� 7|��4W0`�lw�B)�D�D��+��<�N��z�R�]�r��(��ϚiE�c�=?�y�p�������腿�]�?~���l�i.�B��J��g�����yJ�*��r�Й�Ƿ@�Oݠ�YS˻}m���Sd�/=#q�R��9m��]����֟�� x�"L]bƎv|9���;^<r��^8I�������cΌ;��%[�~��9�}#��'%����%A5G��(�o�Eʩ����O�mݽi�Ķi� H!�~���m����2<��J��N�uW��'p='-�w�=0[f�z�̤�n��Z�Q���Hc��(�=��C�rFI��|�/U�мf��sc:5|�N=�yH�}��sT�{h �^!@�����'���O�YRI�"Zvl�F�� ���:Z,H���ITNNu�ǒ��8���AiܨJ6��t�9O�R�t�ש.)Yɚj���s>1X X�fB�E���^FusÐ5�F"Ќe�it��o��� ��wA���>?�+������nD�Lj���+ۧt�0B�'�n@.�J"�+R((�2|��p٦��E4d�haA��^_T�� �S!9�F�#�B༩� ����w�ӉJ,����4�6��i��� +��Yw7�=�,����ģ'P�b���(A%�O�����dh_�E�F3�4�]w�9��b�_�vH�{6�J�B z4�D�v=bi��λ"�}����x�����3��Ӯou]Dk�O,�t�.���֨�;ݫ����6�$��H=���HP��}q/�K�4K��'A{m���u���b�'���T��X[���0��EP `��j|�n29�h��l(Z�E�I��ť�- ��Kz����mv L�=�?g���J�ަj�X`��y��<��� cN�肎��r��B@�O*�]^�8��cō!�������� ��,9�ng/v��Q]X�&6�>�y�Gu= �1(G�B;j~K�'*a��l����A i��l�����p!��sW�QP�,�R"u��A����9<),���U[1����u�_:|��9<�Xa� x;����� ;�g���osS}��z9��Y�,ns~B�1f�*@��~�z�A_��Fp�b�_��ާ���U�0�Cw5&�^Ќ�Yo�����./z�w/�$�"���6���]���j��ST�F�X��2[TVZ]TxU�3Fܕ�*Wv��PLɲ�GG�u�ӑ:ۣ�w��Zpҧ��Xe��4��X� ��ō!1��da�k% ��*���m�:ؿ]�C�b���P^/š }��/03oS��C���Mj��pq��I#�<��������]6�DL_���-��$�njc�Uz�=�)�/U/\5Y�ʸ�(��j�f�,�Z�����"n�$�(�;�-)�K1��oVE�7Q�4;"��MS ec��owq� �T��&i(S�A�/J<s<M��&�[���3�f��� !^h��>~�_����8���M -o��ă�BF�ԛ��T#\��ԑg?����Xs�/�1{UM�OFu�2$��W?������� �ۅQػ0������4}�ɐI�;�䞓k)�T/���vF 5(��C����$M��9�U��^� 3.d��� �4��y<ֽ��0V�i����")P��x��^�ҳ���`�d&FT��"-�Q�J�R��v�.Xɒ �{� ����'����^]�ּ|ȇ��W��a��$F��(.�;�9N�����e����6$?�+n/�v3��X��S ^:J��� �/�M�M�zI�*IS��j��cڙ�el��J�ϙG��h���?8C{O;f����|b�0���]QV��c��p��$�����c�k�sBv��f�tV�X�;�2�:����'�QJ6;����R�+��ݸ����]������B��d�c��$�}�dmQ��Ƽ�⏋��2e�FG-\B������mK<�_^�)���ֺ�'�]���'W���o�<"�Yf~��dOatdGby���@��g�����h9�7�<�0r��]F�Ïm��S#v�Nb��2��-kD��,C�m4��%�lI���@�y��[��x�V���j�uR�%�a��H���]�s�DOU6C�@��٤��u �/#�����a�(�|}|�V��n&�47V��c�3a �Ο��.Z��a�Dؽ=��n����}ґ���������)�HT�4G�x�s�����3����E�x�>�}��G�g�o�jJiDv�h��t��MoC�%cT�HU��m����u2N�]���rr�y�ĀD9���2ݞt0�GM����#�����]��i�a��Zr������&s�{��MBŤ�|�g À�">���d-?)���95S�9�� �v�?��?7ڇpX�����G`��}�"ox�\-�7��zy� "�Z�rnu��G�x� ���P(�_3��?�)A� ٢��W�Il�r��b� |�M�\9+2����?췧��Y�0qdPٹ�_.LD�$��ˢ�����eН�L��37�F~C��&-��Lؐ�{��f�����J/��&@)�L(��?s�6���˔:�_� ΝdQ�-��"��ضK�v���eEn�ׄ�F��Nc������Y��ѝ]�w8�����T.D���n���P������8��6A��oLl��7iv�c>�dn�uV�4m��Tk����m�F��*���bZ�-���ٖf��̑<;[�]TK��ZȉVo���@,z��谏�+�﨑\;�.X���t�/d��R����'�wl�7*dR���6E �q��-r Y��D��1gn%��?o�����9��9ƌ��2����+�3mW��g�YZ.shstrtab.interp.note.gnu.property.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu.build.attributes.gnu_debuglink.gnu_debugdata���� &�� 4$G���o00DQxxpY��Ha���o004n���ohh�}��B�7�7 ��D�D�EE���M�M���V�VUl����� � � �t0 ���������hU��]"�]��]"�]��]"�]@+ ��"�@�@�"@����"�@9 @�"@��L �c@�0 p�(/�����>hfi/hfi1_ioctl.h000064400000014732151703010350007506 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR BSD-3-Clause) */ /* * * This file is provided under a dual BSD/GPLv2 license. When using or * redistributing this file, you may do so under either license. * * GPL LICENSE SUMMARY * * Copyright(c) 2015 Intel Corporation. * * This program is free software; you can redistribute it and/or modify * it under the terms of version 2 of the GNU General Public License as * published by the Free Software Foundation. * * This program is distributed in the hope that it will be useful, but * WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU * General Public License for more details. * * BSD LICENSE * * Copyright(c) 2015 Intel Corporation. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * - Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * - Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * - Neither the name of Intel Corporation nor the names of its * contributors may be used to endorse or promote products derived * from this software without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR * A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT * OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT * LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. * */ #ifndef _LINUX__HFI1_IOCTL_H #define _LINUX__HFI1_IOCTL_H #include <linux/types.h> /* * This structure is passed to the driver to tell it where * user code buffers are, sizes, etc. The offsets and sizes of the * fields must remain unchanged, for binary compatibility. It can * be extended, if userversion is changed so user code can tell, if needed */ struct hfi1_user_info { /* * version of user software, to detect compatibility issues. * Should be set to HFI1_USER_SWVERSION. */ __u32 userversion; __u32 pad; /* * If two or more processes wish to share a context, each process * must set the subcontext_cnt and subcontext_id to the same * values. The only restriction on the subcontext_id is that * it be unique for a given node. */ __u16 subctxt_cnt; __u16 subctxt_id; /* 128bit UUID passed in by PSM. */ __u8 uuid[16]; }; struct hfi1_ctxt_info { __aligned_u64 runtime_flags; /* chip/drv runtime flags (HFI1_CAP_*) */ __u32 rcvegr_size; /* size of each eager buffer */ __u16 num_active; /* number of active units */ __u16 unit; /* unit (chip) assigned to caller */ __u16 ctxt; /* ctxt on unit assigned to caller */ __u16 subctxt; /* subctxt on unit assigned to caller */ __u16 rcvtids; /* number of Rcv TIDs for this context */ __u16 credits; /* number of PIO credits for this context */ __u16 numa_node; /* NUMA node of the assigned device */ __u16 rec_cpu; /* cpu # for affinity (0xffff if none) */ __u16 send_ctxt; /* send context in use by this user context */ __u16 egrtids; /* number of RcvArray entries for Eager Rcvs */ __u16 rcvhdrq_cnt; /* number of RcvHdrQ entries */ __u16 rcvhdrq_entsize; /* size (in bytes) for each RcvHdrQ entry */ __u16 sdma_ring_size; /* number of entries in SDMA request ring */ }; struct hfi1_tid_info { /* virtual address of first page in transfer */ __aligned_u64 vaddr; /* pointer to tid array. this array is big enough */ __aligned_u64 tidlist; /* number of tids programmed by this request */ __u32 tidcnt; /* length of transfer buffer programmed by this request */ __u32 length; }; /* * This structure is returned by the driver immediately after * open to get implementation-specific info, and info specific to this * instance. * * This struct must have explicit pad fields where type sizes * may result in different alignments between 32 and 64 bit * programs, since the 64 bit * bit kernel requires the user code * to have matching offsets */ struct hfi1_base_info { /* version of hardware, for feature checking. */ __u32 hw_version; /* version of software, for feature checking. */ __u32 sw_version; /* Job key */ __u16 jkey; __u16 padding1; /* * The special QP (queue pair) value that identifies PSM * protocol packet from standard IB packets. */ __u32 bthqp; /* PIO credit return address, */ __aligned_u64 sc_credits_addr; /* * Base address of write-only pio buffers for this process. * Each buffer has sendpio_credits*64 bytes. */ __aligned_u64 pio_bufbase_sop; /* * Base address of write-only pio buffers for this process. * Each buffer has sendpio_credits*64 bytes. */ __aligned_u64 pio_bufbase; /* address where receive buffer queue is mapped into */ __aligned_u64 rcvhdr_bufbase; /* base address of Eager receive buffers. */ __aligned_u64 rcvegr_bufbase; /* base address of SDMA completion ring */ __aligned_u64 sdma_comp_bufbase; /* * User register base for init code, not to be used directly by * protocol or applications. Always maps real chip register space. * the register addresses are: * ur_rcvhdrhead, ur_rcvhdrtail, ur_rcvegrhead, ur_rcvegrtail, * ur_rcvtidflow */ __aligned_u64 user_regbase; /* notification events */ __aligned_u64 events_bufbase; /* status page */ __aligned_u64 status_bufbase; /* rcvhdrtail update */ __aligned_u64 rcvhdrtail_base; /* * shared memory pages for subctxts if ctxt is shared; these cover * all the processes in the group sharing a single context. * all have enough space for the num_subcontexts value on this job. */ __aligned_u64 subctxt_uregbase; __aligned_u64 subctxt_rcvegrbuf; __aligned_u64 subctxt_rcvhdrbuf; }; #endif /* _LINIUX__HFI1_IOCTL_H */ hfi/hfi1_user.h000064400000022122151703010350007342 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR BSD-3-Clause) */ /* * * This file is provided under a dual BSD/GPLv2 license. When using or * redistributing this file, you may do so under either license. * * GPL LICENSE SUMMARY * * Copyright(c) 2015 - 2020 Intel Corporation. * * This program is free software; you can redistribute it and/or modify * it under the terms of version 2 of the GNU General Public License as * published by the Free Software Foundation. * * This program is distributed in the hope that it will be useful, but * WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU * General Public License for more details. * * BSD LICENSE * * Copyright(c) 2015 Intel Corporation. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * - Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * - Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * - Neither the name of Intel Corporation nor the names of its * contributors may be used to endorse or promote products derived * from this software without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR * A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT * OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT * LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. * */ /* * This file contains defines, structures, etc. that are used * to communicate between kernel and user code. */ #ifndef _LINUX__HFI1_USER_H #define _LINUX__HFI1_USER_H #include <linux/types.h> #include <rdma/rdma_user_ioctl.h> /* * This version number is given to the driver by the user code during * initialization in the spu_userversion field of hfi1_user_info, so * the driver can check for compatibility with user code. * * The major version changes when data structures change in an incompatible * way. The driver must be the same for initialization to succeed. */ #define HFI1_USER_SWMAJOR 6 /* * Minor version differences are always compatible * a within a major version, however if user software is larger * than driver software, some new features and/or structure fields * may not be implemented; the user code must deal with this if it * cares, or it must abort after initialization reports the difference. */ #define HFI1_USER_SWMINOR 3 /* * We will encode the major/minor inside a single 32bit version number. */ #define HFI1_SWMAJOR_SHIFT 16 /* * Set of HW and driver capability/feature bits. * These bit values are used to configure enabled/disabled HW and * driver features. The same set of bits are communicated to user * space. */ #define HFI1_CAP_DMA_RTAIL (1UL << 0) /* Use DMA'ed RTail value */ #define HFI1_CAP_SDMA (1UL << 1) /* Enable SDMA support */ #define HFI1_CAP_SDMA_AHG (1UL << 2) /* Enable SDMA AHG support */ #define HFI1_CAP_EXTENDED_PSN (1UL << 3) /* Enable Extended PSN support */ #define HFI1_CAP_HDRSUPP (1UL << 4) /* Enable Header Suppression */ #define HFI1_CAP_TID_RDMA (1UL << 5) /* Enable TID RDMA operations */ #define HFI1_CAP_USE_SDMA_HEAD (1UL << 6) /* DMA Hdr Q tail vs. use CSR */ #define HFI1_CAP_MULTI_PKT_EGR (1UL << 7) /* Enable multi-packet Egr buffs*/ #define HFI1_CAP_NODROP_RHQ_FULL (1UL << 8) /* Don't drop on Hdr Q full */ #define HFI1_CAP_NODROP_EGR_FULL (1UL << 9) /* Don't drop on EGR buffs full */ #define HFI1_CAP_TID_UNMAP (1UL << 10) /* Disable Expected TID caching */ #define HFI1_CAP_PRINT_UNIMPL (1UL << 11) /* Show for unimplemented feats */ #define HFI1_CAP_ALLOW_PERM_JKEY (1UL << 12) /* Allow use of permissive JKEY */ #define HFI1_CAP_NO_INTEGRITY (1UL << 13) /* Enable ctxt integrity checks */ #define HFI1_CAP_PKEY_CHECK (1UL << 14) /* Enable ctxt PKey checking */ #define HFI1_CAP_STATIC_RATE_CTRL (1UL << 15) /* Allow PBC.StaticRateControl */ #define HFI1_CAP_OPFN (1UL << 16) /* Enable the OPFN protocol */ #define HFI1_CAP_SDMA_HEAD_CHECK (1UL << 17) /* SDMA head checking */ #define HFI1_CAP_EARLY_CREDIT_RETURN (1UL << 18) /* early credit return */ #define HFI1_CAP_AIP (1UL << 19) /* Enable accelerated IP */ #define HFI1_RCVHDR_ENTSIZE_2 (1UL << 0) #define HFI1_RCVHDR_ENTSIZE_16 (1UL << 1) #define HFI1_RCVDHR_ENTSIZE_32 (1UL << 2) #define _HFI1_EVENT_FROZEN_BIT 0 #define _HFI1_EVENT_LINKDOWN_BIT 1 #define _HFI1_EVENT_LID_CHANGE_BIT 2 #define _HFI1_EVENT_LMC_CHANGE_BIT 3 #define _HFI1_EVENT_SL2VL_CHANGE_BIT 4 #define _HFI1_EVENT_TID_MMU_NOTIFY_BIT 5 #define _HFI1_MAX_EVENT_BIT _HFI1_EVENT_TID_MMU_NOTIFY_BIT #define HFI1_EVENT_FROZEN (1UL << _HFI1_EVENT_FROZEN_BIT) #define HFI1_EVENT_LINKDOWN (1UL << _HFI1_EVENT_LINKDOWN_BIT) #define HFI1_EVENT_LID_CHANGE (1UL << _HFI1_EVENT_LID_CHANGE_BIT) #define HFI1_EVENT_LMC_CHANGE (1UL << _HFI1_EVENT_LMC_CHANGE_BIT) #define HFI1_EVENT_SL2VL_CHANGE (1UL << _HFI1_EVENT_SL2VL_CHANGE_BIT) #define HFI1_EVENT_TID_MMU_NOTIFY (1UL << _HFI1_EVENT_TID_MMU_NOTIFY_BIT) /* * These are the status bits readable (in ASCII form, 64bit value) * from the "status" sysfs file. For binary compatibility, values * must remain as is; removed states can be reused for different * purposes. */ #define HFI1_STATUS_INITTED 0x1 /* basic initialization done */ /* Chip has been found and initialized */ #define HFI1_STATUS_CHIP_PRESENT 0x20 /* IB link is at ACTIVE, usable for data traffic */ #define HFI1_STATUS_IB_READY 0x40 /* link is configured, LID, MTU, etc. have been set */ #define HFI1_STATUS_IB_CONF 0x80 /* A Fatal hardware error has occurred. */ #define HFI1_STATUS_HWERROR 0x200 /* * Number of supported shared contexts. * This is the maximum number of software contexts that can share * a hardware send/receive context. */ #define HFI1_MAX_SHARED_CTXTS 8 /* * Poll types */ #define HFI1_POLL_TYPE_ANYRCV 0x0 #define HFI1_POLL_TYPE_URGENT 0x1 enum hfi1_sdma_comp_state { FREE = 0, QUEUED, COMPLETE, ERROR }; /* * SDMA completion ring entry */ struct hfi1_sdma_comp_entry { __u32 status; __u32 errcode; }; /* * Device status and notifications from driver to user-space. */ struct hfi1_status { __aligned_u64 dev; /* device/hw status bits */ __aligned_u64 port; /* port state and status bits */ char freezemsg[]; }; enum sdma_req_opcode { EXPECTED = 0, EAGER }; #define HFI1_SDMA_REQ_VERSION_MASK 0xF #define HFI1_SDMA_REQ_VERSION_SHIFT 0x0 #define HFI1_SDMA_REQ_OPCODE_MASK 0xF #define HFI1_SDMA_REQ_OPCODE_SHIFT 0x4 #define HFI1_SDMA_REQ_IOVCNT_MASK 0xFF #define HFI1_SDMA_REQ_IOVCNT_SHIFT 0x8 struct sdma_req_info { /* * bits 0-3 - version (currently unused) * bits 4-7 - opcode (enum sdma_req_opcode) * bits 8-15 - io vector count */ __u16 ctrl; /* * Number of fragments contained in this request. * User-space has already computed how many * fragment-sized packet the user buffer will be * split into. */ __u16 npkts; /* * Size of each fragment the user buffer will be * split into. */ __u16 fragsize; /* * Index of the slot in the SDMA completion ring * this request should be using. User-space is * in charge of managing its own ring. */ __u16 comp_idx; } __attribute__((__packed__)); /* * SW KDETH header. * swdata is SW defined portion. */ struct hfi1_kdeth_header { __le32 ver_tid_offset; __le16 jkey; __le16 hcrc; __le32 swdata[7]; } __attribute__((__packed__)); /* * Structure describing the headers that User space uses. The * structure above is a subset of this one. */ struct hfi1_pkt_header { __le16 pbc[4]; __be16 lrh[4]; __be32 bth[3]; struct hfi1_kdeth_header kdeth; } __attribute__((__packed__)); /* * The list of usermode accessible registers. */ enum hfi1_ureg { /* (RO) DMA RcvHdr to be used next. */ ur_rcvhdrtail = 0, /* (RW) RcvHdr entry to be processed next by host. */ ur_rcvhdrhead = 1, /* (RO) Index of next Eager index to use. */ ur_rcvegrindextail = 2, /* (RW) Eager TID to be processed next */ ur_rcvegrindexhead = 3, /* (RO) Receive Eager Offset Tail */ ur_rcvegroffsettail = 4, /* For internal use only; max register number. */ ur_maxreg, /* (RW) Receive TID flow table */ ur_rcvtidflowtable = 256 }; #endif /* _LINIUX__HFI1_USER_H */ bnxt_re-abi.h000064400000006672151703010350007115 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR BSD-2-Clause) */ /* * Broadcom NetXtreme-E RoCE driver. * * Copyright (c) 2016 - 2017, Broadcom. All rights reserved. The term * Broadcom refers to Broadcom Limited and/or its subsidiaries. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * BSD license below: * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * THIS SOFTWARE IS PROVIDED BY THE AUTHOR AND CONTRIBUTORS ``AS IS'' * AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, * THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE AUTHOR OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR * CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF * SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR * BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, * WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE * OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN * IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. * * Description: Uverbs ABI header file */ #ifndef __BNXT_RE_UVERBS_ABI_H__ #define __BNXT_RE_UVERBS_ABI_H__ #include <linux/types.h> #define BNXT_RE_ABI_VERSION 1 #define BNXT_RE_CHIP_ID0_CHIP_NUM_SFT 0x00 #define BNXT_RE_CHIP_ID0_CHIP_REV_SFT 0x10 #define BNXT_RE_CHIP_ID0_CHIP_MET_SFT 0x18 enum { BNXT_RE_UCNTX_CMASK_HAVE_CCTX = 0x1ULL, BNXT_RE_UCNTX_CMASK_HAVE_MODE = 0x02ULL, }; enum bnxt_re_wqe_mode { BNXT_QPLIB_WQE_MODE_STATIC = 0x00, BNXT_QPLIB_WQE_MODE_VARIABLE = 0x01, BNXT_QPLIB_WQE_MODE_INVALID = 0x02, }; struct bnxt_re_uctx_resp { __u32 dev_id; __u32 max_qp; __u32 pg_size; __u32 cqe_sz; __u32 max_cqd; __u32 rsvd; __aligned_u64 comp_mask; __u32 chip_id0; __u32 chip_id1; __u32 mode; __u32 rsvd1; /* padding */ }; /* * This struct is placed after the ib_uverbs_alloc_pd_resp struct, which is * not 8 byted aligned. To avoid undesired padding in various cases we have to * set this struct to packed. */ struct bnxt_re_pd_resp { __u32 pdid; __u32 dpi; __u64 dbr; } __attribute__((packed, aligned(4))); struct bnxt_re_cq_req { __aligned_u64 cq_va; __aligned_u64 cq_handle; }; struct bnxt_re_cq_resp { __u32 cqid; __u32 tail; __u32 phase; __u32 rsvd; }; struct bnxt_re_qp_req { __aligned_u64 qpsva; __aligned_u64 qprva; __aligned_u64 qp_handle; }; struct bnxt_re_qp_resp { __u32 qpid; __u32 rsvd; }; struct bnxt_re_srq_req { __aligned_u64 srqva; __aligned_u64 srq_handle; }; struct bnxt_re_srq_resp { __u32 srqid; }; enum bnxt_re_shpg_offt { BNXT_RE_BEG_RESV_OFFT = 0x00, BNXT_RE_AVID_OFFT = 0x10, BNXT_RE_AVID_SIZE = 0x04, BNXT_RE_END_RESV_OFFT = 0xFF0 }; #endif /* __BNXT_RE_UVERBS_ABI_H__*/ cxgb4-abi.h000064400000006062151703010350006454 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2009-2010 Chelsio, Inc. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef CXGB4_ABI_USER_H #define CXGB4_ABI_USER_H #include <linux/types.h> #define C4IW_UVERBS_ABI_VERSION 3 /* * Make sure that all structs defined in this file remain laid out so * that they pack the same way on 32-bit and 64-bit architectures (to * avoid incompatibility between 32-bit userspace and 64-bit kernels). * In particular do not use pointer types -- pass pointers in __aligned_u64 * instead. */ enum { C4IW_64B_CQE = (1 << 0) }; struct c4iw_create_cq { __u32 flags; __u32 reserved; }; struct c4iw_create_cq_resp { __aligned_u64 key; __aligned_u64 gts_key; __aligned_u64 memsize; __u32 cqid; __u32 size; __u32 qid_mask; __u32 flags; }; enum { C4IW_QPF_ONCHIP = (1 << 0), C4IW_QPF_WRITE_W_IMM = (1 << 1) }; struct c4iw_create_qp_resp { __aligned_u64 ma_sync_key; __aligned_u64 sq_key; __aligned_u64 rq_key; __aligned_u64 sq_db_gts_key; __aligned_u64 rq_db_gts_key; __aligned_u64 sq_memsize; __aligned_u64 rq_memsize; __u32 sqid; __u32 rqid; __u32 sq_size; __u32 rq_size; __u32 qid_mask; __u32 flags; }; struct c4iw_create_srq_resp { __aligned_u64 srq_key; __aligned_u64 srq_db_gts_key; __aligned_u64 srq_memsize; __u32 srqid; __u32 srq_size; __u32 rqt_abs_idx; __u32 qid_mask; __u32 flags; __u32 reserved; /* explicit padding */ }; enum { /* HW supports SRQ_LIMIT_REACHED event */ T4_SRQ_LIMIT_SUPPORT = 1 << 0, }; struct c4iw_alloc_ucontext_resp { __aligned_u64 status_page_key; __u32 status_page_size; __u32 reserved; /* explicit padding (optional for i386) */ }; struct c4iw_alloc_pd_resp { __u32 pdid; }; #endif /* CXGB4_ABI_USER_H */ efa-abi.h000064400000005621151703010350006200 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR BSD-2-Clause) */ /* * Copyright 2018-2023 Amazon.com, Inc. or its affiliates. All rights reserved. */ #ifndef EFA_ABI_USER_H #define EFA_ABI_USER_H #include <linux/types.h> /* * Increment this value if any changes that break userspace ABI * compatibility are made. */ #define EFA_UVERBS_ABI_VERSION 1 /* * Keep structs aligned to 8 bytes. * Keep reserved fields as arrays of __u8 named reserved_XXX where XXX is the * hex bit offset of the field. */ enum { EFA_ALLOC_UCONTEXT_CMD_COMP_TX_BATCH = 1 << 0, EFA_ALLOC_UCONTEXT_CMD_COMP_MIN_SQ_WR = 1 << 1, }; struct efa_ibv_alloc_ucontext_cmd { __u32 comp_mask; __u8 reserved_20[4]; }; enum efa_ibv_user_cmds_supp_udata { EFA_USER_CMDS_SUPP_UDATA_QUERY_DEVICE = 1 << 0, EFA_USER_CMDS_SUPP_UDATA_CREATE_AH = 1 << 1, }; struct efa_ibv_alloc_ucontext_resp { __u32 comp_mask; __u32 cmds_supp_udata_mask; __u16 sub_cqs_per_cq; __u16 inline_buf_size; __u32 max_llq_size; /* bytes */ __u16 max_tx_batch; /* units of 64 bytes */ __u16 min_sq_wr; __u8 reserved_a0[4]; }; struct efa_ibv_alloc_pd_resp { __u32 comp_mask; __u16 pdn; __u8 reserved_30[2]; }; enum { EFA_CREATE_CQ_WITH_COMPLETION_CHANNEL = 1 << 0, EFA_CREATE_CQ_WITH_SGID = 1 << 1, }; struct efa_ibv_create_cq { __u32 comp_mask; __u32 cq_entry_size; __u16 num_sub_cqs; __u8 flags; __u8 reserved_58[5]; }; enum { EFA_CREATE_CQ_RESP_DB_OFF = 1 << 0, }; struct efa_ibv_create_cq_resp { __u32 comp_mask; __u8 reserved_20[4]; __aligned_u64 q_mmap_key; __aligned_u64 q_mmap_size; __u16 cq_idx; __u8 reserved_d0[2]; __u32 db_off; __aligned_u64 db_mmap_key; }; enum { EFA_QP_DRIVER_TYPE_SRD = 0, }; struct efa_ibv_create_qp { __u32 comp_mask; __u32 rq_ring_size; /* bytes */ __u32 sq_ring_size; /* bytes */ __u32 driver_qp_type; }; struct efa_ibv_create_qp_resp { __u32 comp_mask; /* the offset inside the page of the rq db */ __u32 rq_db_offset; /* the offset inside the page of the sq db */ __u32 sq_db_offset; /* the offset inside the page of descriptors buffer */ __u32 llq_desc_offset; __aligned_u64 rq_mmap_key; __aligned_u64 rq_mmap_size; __aligned_u64 rq_db_mmap_key; __aligned_u64 sq_db_mmap_key; __aligned_u64 llq_desc_mmap_key; __u16 send_sub_cq_idx; __u16 recv_sub_cq_idx; __u8 reserved_1e0[4]; }; struct efa_ibv_create_ah_resp { __u32 comp_mask; __u16 efa_address_handle; __u8 reserved_30[2]; }; enum { EFA_QUERY_DEVICE_CAPS_RDMA_READ = 1 << 0, EFA_QUERY_DEVICE_CAPS_RNR_RETRY = 1 << 1, EFA_QUERY_DEVICE_CAPS_CQ_NOTIFICATIONS = 1 << 2, EFA_QUERY_DEVICE_CAPS_CQ_WITH_SGID = 1 << 3, EFA_QUERY_DEVICE_CAPS_DATA_POLLING_128 = 1 << 4, EFA_QUERY_DEVICE_CAPS_RDMA_WRITE = 1 << 5, }; struct efa_ibv_ex_query_device_resp { __u32 comp_mask; __u32 max_sq_wr; __u32 max_rq_wr; __u16 max_sq_sge; __u16 max_rq_sge; __u32 max_rdma_size; __u32 device_caps; }; #endif /* EFA_ABI_USER_H */ hns-abi.h000064400000004237151703010350006237 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2016 Hisilicon Limited. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef HNS_ABI_USER_H #define HNS_ABI_USER_H #include <linux/types.h> struct hns_roce_ib_create_cq { __aligned_u64 buf_addr; __aligned_u64 db_addr; }; struct hns_roce_ib_create_cq_resp { __aligned_u64 cqn; /* Only 32 bits used, 64 for compat */ __aligned_u64 cap_flags; }; struct hns_roce_ib_create_qp { __aligned_u64 buf_addr; __aligned_u64 db_addr; __u8 log_sq_bb_count; __u8 log_sq_stride; __u8 sq_no_prefetch; __u8 reserved[5]; __aligned_u64 sdb_addr; }; struct hns_roce_ib_create_qp_resp { __aligned_u64 cap_flags; }; struct hns_roce_ib_alloc_ucontext_resp { __u32 qp_tab_size; __u32 reserved; }; struct hns_roce_ib_alloc_pd_resp { __u32 pdn; }; #endif /* HNS_ABI_USER_H */ ib_user_ioctl_cmds.h000064400000022326151703010350010545 0ustar00/* * Copyright (c) 2018, Mellanox Technologies inc. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef IB_USER_IOCTL_CMDS_H #define IB_USER_IOCTL_CMDS_H #define UVERBS_ID_NS_MASK 0xF000 #define UVERBS_ID_NS_SHIFT 12 #define UVERBS_UDATA_DRIVER_DATA_NS 1 #define UVERBS_UDATA_DRIVER_DATA_FLAG (1UL << UVERBS_ID_NS_SHIFT) enum uverbs_default_objects { UVERBS_OBJECT_DEVICE, /* No instances of DEVICE are allowed */ UVERBS_OBJECT_PD, UVERBS_OBJECT_COMP_CHANNEL, UVERBS_OBJECT_CQ, UVERBS_OBJECT_QP, UVERBS_OBJECT_SRQ, UVERBS_OBJECT_AH, UVERBS_OBJECT_MR, UVERBS_OBJECT_MW, UVERBS_OBJECT_FLOW, UVERBS_OBJECT_XRCD, UVERBS_OBJECT_RWQ_IND_TBL, UVERBS_OBJECT_WQ, UVERBS_OBJECT_FLOW_ACTION, UVERBS_OBJECT_DM, UVERBS_OBJECT_COUNTERS, UVERBS_OBJECT_ASYNC_EVENT, }; enum { UVERBS_ATTR_UHW_IN = UVERBS_UDATA_DRIVER_DATA_FLAG, UVERBS_ATTR_UHW_OUT, }; enum uverbs_methods_device { UVERBS_METHOD_INVOKE_WRITE, UVERBS_METHOD_INFO_HANDLES, UVERBS_METHOD_QUERY_PORT, UVERBS_METHOD_GET_CONTEXT, UVERBS_METHOD_QUERY_CONTEXT, UVERBS_METHOD_QUERY_GID_TABLE, UVERBS_METHOD_QUERY_GID_ENTRY, }; enum uverbs_attrs_invoke_write_cmd_attr_ids { UVERBS_ATTR_CORE_IN, UVERBS_ATTR_CORE_OUT, UVERBS_ATTR_WRITE_CMD, }; enum uverbs_attrs_query_port_cmd_attr_ids { UVERBS_ATTR_QUERY_PORT_PORT_NUM, UVERBS_ATTR_QUERY_PORT_RESP, }; enum uverbs_attrs_get_context_attr_ids { UVERBS_ATTR_GET_CONTEXT_NUM_COMP_VECTORS, UVERBS_ATTR_GET_CONTEXT_CORE_SUPPORT, }; enum uverbs_attrs_query_context_attr_ids { UVERBS_ATTR_QUERY_CONTEXT_NUM_COMP_VECTORS, UVERBS_ATTR_QUERY_CONTEXT_CORE_SUPPORT, }; enum uverbs_attrs_create_cq_cmd_attr_ids { UVERBS_ATTR_CREATE_CQ_HANDLE, UVERBS_ATTR_CREATE_CQ_CQE, UVERBS_ATTR_CREATE_CQ_USER_HANDLE, UVERBS_ATTR_CREATE_CQ_COMP_CHANNEL, UVERBS_ATTR_CREATE_CQ_COMP_VECTOR, UVERBS_ATTR_CREATE_CQ_FLAGS, UVERBS_ATTR_CREATE_CQ_RESP_CQE, UVERBS_ATTR_CREATE_CQ_EVENT_FD, }; enum uverbs_attrs_destroy_cq_cmd_attr_ids { UVERBS_ATTR_DESTROY_CQ_HANDLE, UVERBS_ATTR_DESTROY_CQ_RESP, }; enum uverbs_attrs_create_flow_action_esp { UVERBS_ATTR_CREATE_FLOW_ACTION_ESP_HANDLE, UVERBS_ATTR_FLOW_ACTION_ESP_ATTRS, UVERBS_ATTR_FLOW_ACTION_ESP_ESN, UVERBS_ATTR_FLOW_ACTION_ESP_KEYMAT, UVERBS_ATTR_FLOW_ACTION_ESP_REPLAY, UVERBS_ATTR_FLOW_ACTION_ESP_ENCAP, }; enum uverbs_attrs_modify_flow_action_esp { UVERBS_ATTR_MODIFY_FLOW_ACTION_ESP_HANDLE = UVERBS_ATTR_CREATE_FLOW_ACTION_ESP_HANDLE, }; enum uverbs_attrs_destroy_flow_action_esp { UVERBS_ATTR_DESTROY_FLOW_ACTION_HANDLE, }; enum uverbs_attrs_create_qp_cmd_attr_ids { UVERBS_ATTR_CREATE_QP_HANDLE, UVERBS_ATTR_CREATE_QP_XRCD_HANDLE, UVERBS_ATTR_CREATE_QP_PD_HANDLE, UVERBS_ATTR_CREATE_QP_SRQ_HANDLE, UVERBS_ATTR_CREATE_QP_SEND_CQ_HANDLE, UVERBS_ATTR_CREATE_QP_RECV_CQ_HANDLE, UVERBS_ATTR_CREATE_QP_IND_TABLE_HANDLE, UVERBS_ATTR_CREATE_QP_USER_HANDLE, UVERBS_ATTR_CREATE_QP_CAP, UVERBS_ATTR_CREATE_QP_TYPE, UVERBS_ATTR_CREATE_QP_FLAGS, UVERBS_ATTR_CREATE_QP_SOURCE_QPN, UVERBS_ATTR_CREATE_QP_EVENT_FD, UVERBS_ATTR_CREATE_QP_RESP_CAP, UVERBS_ATTR_CREATE_QP_RESP_QP_NUM, }; enum uverbs_attrs_destroy_qp_cmd_attr_ids { UVERBS_ATTR_DESTROY_QP_HANDLE, UVERBS_ATTR_DESTROY_QP_RESP, }; enum uverbs_methods_qp { UVERBS_METHOD_QP_CREATE, UVERBS_METHOD_QP_DESTROY, }; enum uverbs_attrs_create_srq_cmd_attr_ids { UVERBS_ATTR_CREATE_SRQ_HANDLE, UVERBS_ATTR_CREATE_SRQ_PD_HANDLE, UVERBS_ATTR_CREATE_SRQ_XRCD_HANDLE, UVERBS_ATTR_CREATE_SRQ_CQ_HANDLE, UVERBS_ATTR_CREATE_SRQ_USER_HANDLE, UVERBS_ATTR_CREATE_SRQ_MAX_WR, UVERBS_ATTR_CREATE_SRQ_MAX_SGE, UVERBS_ATTR_CREATE_SRQ_LIMIT, UVERBS_ATTR_CREATE_SRQ_MAX_NUM_TAGS, UVERBS_ATTR_CREATE_SRQ_TYPE, UVERBS_ATTR_CREATE_SRQ_EVENT_FD, UVERBS_ATTR_CREATE_SRQ_RESP_MAX_WR, UVERBS_ATTR_CREATE_SRQ_RESP_MAX_SGE, UVERBS_ATTR_CREATE_SRQ_RESP_SRQ_NUM, }; enum uverbs_attrs_destroy_srq_cmd_attr_ids { UVERBS_ATTR_DESTROY_SRQ_HANDLE, UVERBS_ATTR_DESTROY_SRQ_RESP, }; enum uverbs_methods_srq { UVERBS_METHOD_SRQ_CREATE, UVERBS_METHOD_SRQ_DESTROY, }; enum uverbs_methods_cq { UVERBS_METHOD_CQ_CREATE, UVERBS_METHOD_CQ_DESTROY, }; enum uverbs_attrs_create_wq_cmd_attr_ids { UVERBS_ATTR_CREATE_WQ_HANDLE, UVERBS_ATTR_CREATE_WQ_PD_HANDLE, UVERBS_ATTR_CREATE_WQ_CQ_HANDLE, UVERBS_ATTR_CREATE_WQ_USER_HANDLE, UVERBS_ATTR_CREATE_WQ_TYPE, UVERBS_ATTR_CREATE_WQ_EVENT_FD, UVERBS_ATTR_CREATE_WQ_MAX_WR, UVERBS_ATTR_CREATE_WQ_MAX_SGE, UVERBS_ATTR_CREATE_WQ_FLAGS, UVERBS_ATTR_CREATE_WQ_RESP_MAX_WR, UVERBS_ATTR_CREATE_WQ_RESP_MAX_SGE, UVERBS_ATTR_CREATE_WQ_RESP_WQ_NUM, }; enum uverbs_attrs_destroy_wq_cmd_attr_ids { UVERBS_ATTR_DESTROY_WQ_HANDLE, UVERBS_ATTR_DESTROY_WQ_RESP, }; enum uverbs_methods_wq { UVERBS_METHOD_WQ_CREATE, UVERBS_METHOD_WQ_DESTROY, }; enum uverbs_methods_actions_flow_action_ops { UVERBS_METHOD_FLOW_ACTION_ESP_CREATE, UVERBS_METHOD_FLOW_ACTION_DESTROY, UVERBS_METHOD_FLOW_ACTION_ESP_MODIFY, }; enum uverbs_attrs_alloc_dm_cmd_attr_ids { UVERBS_ATTR_ALLOC_DM_HANDLE, UVERBS_ATTR_ALLOC_DM_LENGTH, UVERBS_ATTR_ALLOC_DM_ALIGNMENT, }; enum uverbs_attrs_free_dm_cmd_attr_ids { UVERBS_ATTR_FREE_DM_HANDLE, }; enum uverbs_methods_dm { UVERBS_METHOD_DM_ALLOC, UVERBS_METHOD_DM_FREE, }; enum uverbs_attrs_reg_dm_mr_cmd_attr_ids { UVERBS_ATTR_REG_DM_MR_HANDLE, UVERBS_ATTR_REG_DM_MR_OFFSET, UVERBS_ATTR_REG_DM_MR_LENGTH, UVERBS_ATTR_REG_DM_MR_PD_HANDLE, UVERBS_ATTR_REG_DM_MR_ACCESS_FLAGS, UVERBS_ATTR_REG_DM_MR_DM_HANDLE, UVERBS_ATTR_REG_DM_MR_RESP_LKEY, UVERBS_ATTR_REG_DM_MR_RESP_RKEY, }; enum uverbs_methods_mr { UVERBS_METHOD_DM_MR_REG, UVERBS_METHOD_MR_DESTROY, UVERBS_METHOD_ADVISE_MR, UVERBS_METHOD_QUERY_MR, }; enum uverbs_attrs_mr_destroy_ids { UVERBS_ATTR_DESTROY_MR_HANDLE, }; enum uverbs_attrs_advise_mr_cmd_attr_ids { UVERBS_ATTR_ADVISE_MR_PD_HANDLE, UVERBS_ATTR_ADVISE_MR_ADVICE, UVERBS_ATTR_ADVISE_MR_FLAGS, UVERBS_ATTR_ADVISE_MR_SGE_LIST, }; enum uverbs_attrs_query_mr_cmd_attr_ids { UVERBS_ATTR_QUERY_MR_HANDLE, UVERBS_ATTR_QUERY_MR_RESP_LKEY, UVERBS_ATTR_QUERY_MR_RESP_RKEY, UVERBS_ATTR_QUERY_MR_RESP_LENGTH, UVERBS_ATTR_QUERY_MR_RESP_IOVA, }; enum uverbs_attrs_create_counters_cmd_attr_ids { UVERBS_ATTR_CREATE_COUNTERS_HANDLE, }; enum uverbs_attrs_destroy_counters_cmd_attr_ids { UVERBS_ATTR_DESTROY_COUNTERS_HANDLE, }; enum uverbs_attrs_read_counters_cmd_attr_ids { UVERBS_ATTR_READ_COUNTERS_HANDLE, UVERBS_ATTR_READ_COUNTERS_BUFF, UVERBS_ATTR_READ_COUNTERS_FLAGS, }; enum uverbs_methods_actions_counters_ops { UVERBS_METHOD_COUNTERS_CREATE, UVERBS_METHOD_COUNTERS_DESTROY, UVERBS_METHOD_COUNTERS_READ, }; enum uverbs_attrs_info_handles_id { UVERBS_ATTR_INFO_OBJECT_ID, UVERBS_ATTR_INFO_TOTAL_HANDLES, UVERBS_ATTR_INFO_HANDLES_LIST, }; enum uverbs_methods_pd { UVERBS_METHOD_PD_DESTROY, }; enum uverbs_attrs_pd_destroy_ids { UVERBS_ATTR_DESTROY_PD_HANDLE, }; enum uverbs_methods_mw { UVERBS_METHOD_MW_DESTROY, }; enum uverbs_attrs_mw_destroy_ids { UVERBS_ATTR_DESTROY_MW_HANDLE, }; enum uverbs_methods_xrcd { UVERBS_METHOD_XRCD_DESTROY, }; enum uverbs_attrs_xrcd_destroy_ids { UVERBS_ATTR_DESTROY_XRCD_HANDLE, }; enum uverbs_methods_ah { UVERBS_METHOD_AH_DESTROY, }; enum uverbs_attrs_ah_destroy_ids { UVERBS_ATTR_DESTROY_AH_HANDLE, }; enum uverbs_methods_rwq_ind_tbl { UVERBS_METHOD_RWQ_IND_TBL_DESTROY, }; enum uverbs_attrs_rwq_ind_tbl_destroy_ids { UVERBS_ATTR_DESTROY_RWQ_IND_TBL_HANDLE, }; enum uverbs_methods_flow { UVERBS_METHOD_FLOW_DESTROY, }; enum uverbs_attrs_flow_destroy_ids { UVERBS_ATTR_DESTROY_FLOW_HANDLE, }; enum uverbs_method_async_event { UVERBS_METHOD_ASYNC_EVENT_ALLOC, }; enum uverbs_attrs_async_event_create { UVERBS_ATTR_ASYNC_EVENT_ALLOC_FD_HANDLE, }; enum uverbs_attrs_query_gid_table_cmd_attr_ids { UVERBS_ATTR_QUERY_GID_TABLE_ENTRY_SIZE, UVERBS_ATTR_QUERY_GID_TABLE_FLAGS, UVERBS_ATTR_QUERY_GID_TABLE_RESP_ENTRIES, UVERBS_ATTR_QUERY_GID_TABLE_RESP_NUM_ENTRIES, }; enum uverbs_attrs_query_gid_entry_cmd_attr_ids { UVERBS_ATTR_QUERY_GID_ENTRY_PORT, UVERBS_ATTR_QUERY_GID_ENTRY_GID_INDEX, UVERBS_ATTR_QUERY_GID_ENTRY_FLAGS, UVERBS_ATTR_QUERY_GID_ENTRY_RESP_ENTRY, }; #endif ib_user_ioctl_verbs.h000064400000017312151703010350010737 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2017-2018, Mellanox Technologies inc. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef IB_USER_IOCTL_VERBS_H #define IB_USER_IOCTL_VERBS_H #include <linux/types.h> #include <rdma/ib_user_verbs.h> #ifndef RDMA_UAPI_PTR #define RDMA_UAPI_PTR(_type, _name) __aligned_u64 _name #endif #define IB_UVERBS_ACCESS_OPTIONAL_FIRST (1 << 20) #define IB_UVERBS_ACCESS_OPTIONAL_LAST (1 << 29) enum ib_uverbs_core_support { IB_UVERBS_CORE_SUPPORT_OPTIONAL_MR_ACCESS = 1 << 0, }; enum ib_uverbs_access_flags { IB_UVERBS_ACCESS_LOCAL_WRITE = 1 << 0, IB_UVERBS_ACCESS_REMOTE_WRITE = 1 << 1, IB_UVERBS_ACCESS_REMOTE_READ = 1 << 2, IB_UVERBS_ACCESS_REMOTE_ATOMIC = 1 << 3, IB_UVERBS_ACCESS_MW_BIND = 1 << 4, IB_UVERBS_ACCESS_ZERO_BASED = 1 << 5, IB_UVERBS_ACCESS_ON_DEMAND = 1 << 6, IB_UVERBS_ACCESS_HUGETLB = 1 << 7, IB_UVERBS_ACCESS_FLUSH_GLOBAL = 1 << 8, IB_UVERBS_ACCESS_FLUSH_PERSISTENT = 1 << 9, IB_UVERBS_ACCESS_RELAXED_ORDERING = IB_UVERBS_ACCESS_OPTIONAL_FIRST, IB_UVERBS_ACCESS_OPTIONAL_RANGE = ((IB_UVERBS_ACCESS_OPTIONAL_LAST << 1) - 1) & ~(IB_UVERBS_ACCESS_OPTIONAL_FIRST - 1) }; enum ib_uverbs_srq_type { IB_UVERBS_SRQT_BASIC, IB_UVERBS_SRQT_XRC, IB_UVERBS_SRQT_TM, }; enum ib_uverbs_wq_type { IB_UVERBS_WQT_RQ, }; enum ib_uverbs_wq_flags { IB_UVERBS_WQ_FLAGS_CVLAN_STRIPPING = 1 << 0, IB_UVERBS_WQ_FLAGS_SCATTER_FCS = 1 << 1, IB_UVERBS_WQ_FLAGS_DELAY_DROP = 1 << 2, IB_UVERBS_WQ_FLAGS_PCI_WRITE_END_PADDING = 1 << 3, }; enum ib_uverbs_qp_type { IB_UVERBS_QPT_RC = 2, IB_UVERBS_QPT_UC, IB_UVERBS_QPT_UD, IB_UVERBS_QPT_RAW_PACKET = 8, IB_UVERBS_QPT_XRC_INI, IB_UVERBS_QPT_XRC_TGT, IB_UVERBS_QPT_DRIVER = 0xFF, }; enum ib_uverbs_qp_create_flags { IB_UVERBS_QP_CREATE_BLOCK_MULTICAST_LOOPBACK = 1 << 1, IB_UVERBS_QP_CREATE_SCATTER_FCS = 1 << 8, IB_UVERBS_QP_CREATE_CVLAN_STRIPPING = 1 << 9, IB_UVERBS_QP_CREATE_PCI_WRITE_END_PADDING = 1 << 11, IB_UVERBS_QP_CREATE_SQ_SIG_ALL = 1 << 12, }; enum ib_uverbs_query_port_cap_flags { IB_UVERBS_PCF_SM = 1 << 1, IB_UVERBS_PCF_NOTICE_SUP = 1 << 2, IB_UVERBS_PCF_TRAP_SUP = 1 << 3, IB_UVERBS_PCF_OPT_IPD_SUP = 1 << 4, IB_UVERBS_PCF_AUTO_MIGR_SUP = 1 << 5, IB_UVERBS_PCF_SL_MAP_SUP = 1 << 6, IB_UVERBS_PCF_MKEY_NVRAM = 1 << 7, IB_UVERBS_PCF_PKEY_NVRAM = 1 << 8, IB_UVERBS_PCF_LED_INFO_SUP = 1 << 9, IB_UVERBS_PCF_SM_DISABLED = 1 << 10, IB_UVERBS_PCF_SYS_IMAGE_GUID_SUP = 1 << 11, IB_UVERBS_PCF_PKEY_SW_EXT_PORT_TRAP_SUP = 1 << 12, IB_UVERBS_PCF_EXTENDED_SPEEDS_SUP = 1 << 14, IB_UVERBS_PCF_CM_SUP = 1 << 16, IB_UVERBS_PCF_SNMP_TUNNEL_SUP = 1 << 17, IB_UVERBS_PCF_REINIT_SUP = 1 << 18, IB_UVERBS_PCF_DEVICE_MGMT_SUP = 1 << 19, IB_UVERBS_PCF_VENDOR_CLASS_SUP = 1 << 20, IB_UVERBS_PCF_DR_NOTICE_SUP = 1 << 21, IB_UVERBS_PCF_CAP_MASK_NOTICE_SUP = 1 << 22, IB_UVERBS_PCF_BOOT_MGMT_SUP = 1 << 23, IB_UVERBS_PCF_LINK_LATENCY_SUP = 1 << 24, IB_UVERBS_PCF_CLIENT_REG_SUP = 1 << 25, /* * IsOtherLocalChangesNoticeSupported is aliased by IP_BASED_GIDS and * is inaccessible */ IB_UVERBS_PCF_LINK_SPEED_WIDTH_TABLE_SUP = 1 << 27, IB_UVERBS_PCF_VENDOR_SPECIFIC_MADS_TABLE_SUP = 1 << 28, IB_UVERBS_PCF_MCAST_PKEY_TRAP_SUPPRESSION_SUP = 1 << 29, IB_UVERBS_PCF_MCAST_FDB_TOP_SUP = 1 << 30, IB_UVERBS_PCF_HIERARCHY_INFO_SUP = 1ULL << 31, /* NOTE this is an internal flag, not an IBA flag */ IB_UVERBS_PCF_IP_BASED_GIDS = 1 << 26, }; enum ib_uverbs_query_port_flags { IB_UVERBS_QPF_GRH_REQUIRED = 1 << 0, }; enum ib_uverbs_flow_action_esp_keymat { IB_UVERBS_FLOW_ACTION_ESP_KEYMAT_AES_GCM, }; enum ib_uverbs_flow_action_esp_keymat_aes_gcm_iv_algo { IB_UVERBS_FLOW_ACTION_IV_ALGO_SEQ, }; struct ib_uverbs_flow_action_esp_keymat_aes_gcm { __aligned_u64 iv; __u32 iv_algo; /* Use enum ib_uverbs_flow_action_esp_keymat_aes_gcm_iv_algo */ __u32 salt; __u32 icv_len; __u32 key_len; __u32 aes_key[256 / 32]; }; enum ib_uverbs_flow_action_esp_replay { IB_UVERBS_FLOW_ACTION_ESP_REPLAY_NONE, IB_UVERBS_FLOW_ACTION_ESP_REPLAY_BMP, }; struct ib_uverbs_flow_action_esp_replay_bmp { __u32 size; }; enum ib_uverbs_flow_action_esp_flags { IB_UVERBS_FLOW_ACTION_ESP_FLAGS_INLINE_CRYPTO = 0UL << 0, /* Default */ IB_UVERBS_FLOW_ACTION_ESP_FLAGS_FULL_OFFLOAD = 1UL << 0, IB_UVERBS_FLOW_ACTION_ESP_FLAGS_TUNNEL = 0UL << 1, /* Default */ IB_UVERBS_FLOW_ACTION_ESP_FLAGS_TRANSPORT = 1UL << 1, IB_UVERBS_FLOW_ACTION_ESP_FLAGS_DECRYPT = 0UL << 2, /* Default */ IB_UVERBS_FLOW_ACTION_ESP_FLAGS_ENCRYPT = 1UL << 2, IB_UVERBS_FLOW_ACTION_ESP_FLAGS_ESN_NEW_WINDOW = 1UL << 3, }; struct ib_uverbs_flow_action_esp_encap { /* This struct represents a list of pointers to flow_xxxx_filter that * encapsulates the payload in ESP tunnel mode. */ RDMA_UAPI_PTR(void *, val_ptr); /* pointer to a flow_xxxx_filter */ RDMA_UAPI_PTR(struct ib_uverbs_flow_action_esp_encap *, next_ptr); __u16 len; /* Len of the filter struct val_ptr points to */ __u16 type; /* Use flow_spec_type enum */ }; struct ib_uverbs_flow_action_esp { __u32 spi; __u32 seq; __u32 tfc_pad; __u32 flags; __aligned_u64 hard_limit_pkts; }; enum ib_uverbs_read_counters_flags { /* prefer read values from driver cache */ IB_UVERBS_READ_COUNTERS_PREFER_CACHED = 1 << 0, }; enum ib_uverbs_advise_mr_advice { IB_UVERBS_ADVISE_MR_ADVICE_PREFETCH, IB_UVERBS_ADVISE_MR_ADVICE_PREFETCH_WRITE, }; enum ib_uverbs_advise_mr_flag { IB_UVERBS_ADVISE_MR_FLAG_FLUSH = 1 << 0, }; struct ib_uverbs_query_port_resp_ex { struct ib_uverbs_query_port_resp legacy_resp; __u16 port_cap_flags2; __u8 reserved[6]; }; struct ib_uverbs_qp_cap { __u32 max_send_wr; __u32 max_recv_wr; __u32 max_send_sge; __u32 max_recv_sge; __u32 max_inline_data; }; enum rdma_driver_id { RDMA_DRIVER_UNKNOWN, RDMA_DRIVER_MLX5, RDMA_DRIVER_MLX4, RDMA_DRIVER_CXGB3, RDMA_DRIVER_CXGB4, RDMA_DRIVER_MTHCA, RDMA_DRIVER_BNXT_RE, RDMA_DRIVER_OCRDMA, RDMA_DRIVER_NES, RDMA_DRIVER_I40IW, RDMA_DRIVER_IRDMA = RDMA_DRIVER_I40IW, RDMA_DRIVER_VMW_PVRDMA, RDMA_DRIVER_QEDR, RDMA_DRIVER_HNS, RDMA_DRIVER_USNIC, RDMA_DRIVER_RXE, RDMA_DRIVER_HFI1, RDMA_DRIVER_QIB, RDMA_DRIVER_EFA, RDMA_DRIVER_SIW, __RH_RESERVED_RDMA_DRIVER_ERDMA, RDMA_DRIVER_MANA, }; enum ib_uverbs_gid_type { IB_UVERBS_GID_TYPE_IB, IB_UVERBS_GID_TYPE_ROCE_V1, IB_UVERBS_GID_TYPE_ROCE_V2, }; struct ib_uverbs_gid_entry { __aligned_u64 gid[2]; __u32 gid_index; __u32 port_num; __u32 gid_type; __u32 netdev_ifindex; /* It is 0 if there is no netdev associated with it */ }; #endif ib_user_mad.h000064400000020522151703010350007162 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2004 Topspin Communications. All rights reserved. * Copyright (c) 2005 Voltaire, Inc. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef IB_USER_MAD_H #define IB_USER_MAD_H #include <linux/types.h> #include <rdma/rdma_user_ioctl.h> /* * Increment this value if any changes that break userspace ABI * compatibility are made. */ #define IB_USER_MAD_ABI_VERSION 5 /* * Make sure that all structs defined in this file remain laid out so * that they pack the same way on 32-bit and 64-bit architectures (to * avoid incompatibility between 32-bit userspace and 64-bit kernels). */ /** * ib_user_mad_hdr_old - Old version of MAD packet header without pkey_index * @id - ID of agent MAD received with/to be sent with * @status - 0 on successful receive, ETIMEDOUT if no response * received (transaction ID in data[] will be set to TID of original * request) (ignored on send) * @timeout_ms - Milliseconds to wait for response (unset on receive) * @retries - Number of automatic retries to attempt * @qpn - Remote QP number received from/to be sent to * @qkey - Remote Q_Key to be sent with (unset on receive) * @lid - Remote lid received from/to be sent to * @sl - Service level received with/to be sent with * @path_bits - Local path bits received with/to be sent with * @grh_present - If set, GRH was received/should be sent * @gid_index - Local GID index to send with (unset on receive) * @hop_limit - Hop limit in GRH * @traffic_class - Traffic class in GRH * @gid - Remote GID in GRH * @flow_label - Flow label in GRH */ struct ib_user_mad_hdr_old { __u32 id; __u32 status; __u32 timeout_ms; __u32 retries; __u32 length; __be32 qpn; __be32 qkey; __be16 lid; __u8 sl; __u8 path_bits; __u8 grh_present; __u8 gid_index; __u8 hop_limit; __u8 traffic_class; __u8 gid[16]; __be32 flow_label; }; /** * ib_user_mad_hdr - MAD packet header * This layout allows specifying/receiving the P_Key index. To use * this capability, an application must call the * IB_USER_MAD_ENABLE_PKEY ioctl on the user MAD file handle before * any other actions with the file handle. * @id - ID of agent MAD received with/to be sent with * @status - 0 on successful receive, ETIMEDOUT if no response * received (transaction ID in data[] will be set to TID of original * request) (ignored on send) * @timeout_ms - Milliseconds to wait for response (unset on receive) * @retries - Number of automatic retries to attempt * @qpn - Remote QP number received from/to be sent to * @qkey - Remote Q_Key to be sent with (unset on receive) * @lid - Remote lid received from/to be sent to * @sl - Service level received with/to be sent with * @path_bits - Local path bits received with/to be sent with * @grh_present - If set, GRH was received/should be sent * @gid_index - Local GID index to send with (unset on receive) * @hop_limit - Hop limit in GRH * @traffic_class - Traffic class in GRH * @gid - Remote GID in GRH * @flow_label - Flow label in GRH * @pkey_index - P_Key index */ struct ib_user_mad_hdr { __u32 id; __u32 status; __u32 timeout_ms; __u32 retries; __u32 length; __be32 qpn; __be32 qkey; __be16 lid; __u8 sl; __u8 path_bits; __u8 grh_present; __u8 gid_index; __u8 hop_limit; __u8 traffic_class; __u8 gid[16]; __be32 flow_label; __u16 pkey_index; __u8 reserved[6]; }; /** * ib_user_mad - MAD packet * @hdr - MAD packet header * @data - Contents of MAD * */ struct ib_user_mad { struct ib_user_mad_hdr hdr; __aligned_u64 data[]; }; /* * Earlier versions of this interface definition declared the * method_mask[] member as an array of __u32 but treated it as a * bitmap made up of longs in the kernel. This ambiguity meant that * 32-bit big-endian applications that can run on both 32-bit and * 64-bit kernels had no consistent ABI to rely on, and 64-bit * big-endian applications that treated method_mask as being made up * of 32-bit words would have their bitmap misinterpreted. * * To clear up this confusion, we change the declaration of * method_mask[] to use unsigned long and handle the conversion from * 32-bit userspace to 64-bit kernel for big-endian systems in the * compat_ioctl method. Unfortunately, to keep the structure layout * the same, we need the method_mask[] array to be aligned only to 4 * bytes even when long is 64 bits, which forces us into this ugly * typedef. */ typedef unsigned long __attribute__((aligned(4))) packed_ulong; #define IB_USER_MAD_LONGS_PER_METHOD_MASK (128 / (8 * sizeof (long))) /** * ib_user_mad_reg_req - MAD registration request * @id - Set by the kernel; used to identify agent in future requests. * @qpn - Queue pair number; must be 0 or 1. * @method_mask - The caller will receive unsolicited MADs for any method * where @method_mask = 1. * @mgmt_class - Indicates which management class of MADs should be receive * by the caller. This field is only required if the user wishes to * receive unsolicited MADs, otherwise it should be 0. * @mgmt_class_version - Indicates which version of MADs for the given * management class to receive. * @oui: Indicates IEEE OUI when mgmt_class is a vendor class * in the range from 0x30 to 0x4f. Otherwise not used. * @rmpp_version: If set, indicates the RMPP version used. * */ struct ib_user_mad_reg_req { __u32 id; packed_ulong method_mask[IB_USER_MAD_LONGS_PER_METHOD_MASK]; __u8 qpn; __u8 mgmt_class; __u8 mgmt_class_version; __u8 oui[3]; __u8 rmpp_version; }; /** * ib_user_mad_reg_req2 - MAD registration request * * @id - Set by the _kernel_; used by userspace to identify the * registered agent in future requests. * @qpn - Queue pair number; must be 0 or 1. * @mgmt_class - Indicates which management class of MADs should be * receive by the caller. This field is only required if * the user wishes to receive unsolicited MADs, otherwise * it should be 0. * @mgmt_class_version - Indicates which version of MADs for the given * management class to receive. * @res - Ignored. * @flags - additional registration flags; Must be in the set of * flags defined in IB_USER_MAD_REG_FLAGS_CAP * @method_mask - The caller wishes to receive unsolicited MADs for the * methods whose bit(s) is(are) set. * @oui - Indicates IEEE OUI to use when mgmt_class is a vendor * class in the range from 0x30 to 0x4f. Otherwise not * used. * @rmpp_version - If set, indicates the RMPP version to use. */ enum { IB_USER_MAD_USER_RMPP = (1 << 0), }; #define IB_USER_MAD_REG_FLAGS_CAP (IB_USER_MAD_USER_RMPP) struct ib_user_mad_reg_req2 { __u32 id; __u32 qpn; __u8 mgmt_class; __u8 mgmt_class_version; __u16 res; __u32 flags; __aligned_u64 method_mask[2]; __u32 oui; __u8 rmpp_version; __u8 reserved[3]; }; #endif /* IB_USER_MAD_H */ ib_user_sa.h000064400000004401151703010350007022 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2005 Intel Corporation. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef IB_USER_SA_H #define IB_USER_SA_H #include <linux/types.h> enum { IB_PATH_GMP = 1, IB_PATH_PRIMARY = (1<<1), IB_PATH_ALTERNATE = (1<<2), IB_PATH_OUTBOUND = (1<<3), IB_PATH_INBOUND = (1<<4), IB_PATH_INBOUND_REVERSE = (1<<5), IB_PATH_BIDIRECTIONAL = IB_PATH_OUTBOUND | IB_PATH_INBOUND_REVERSE }; struct ib_path_rec_data { __u32 flags; __u32 reserved; __u32 path_rec[16]; }; struct ib_user_path_rec { __u8 dgid[16]; __u8 sgid[16]; __be16 dlid; __be16 slid; __u32 raw_traffic; __be32 flow_label; __u32 reversible; __u32 mtu; __be16 pkey; __u8 hop_limit; __u8 traffic_class; __u8 numb_path; __u8 sl; __u8 mtu_selector; __u8 rate_selector; __u8 rate; __u8 packet_life_time_selector; __u8 packet_life_time; __u8 preference; }; #endif /* IB_USER_SA_H */ ib_user_verbs.h000064400000070445151703010350007553 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2005 Topspin Communications. All rights reserved. * Copyright (c) 2005, 2006 Cisco Systems. All rights reserved. * Copyright (c) 2005 PathScale, Inc. All rights reserved. * Copyright (c) 2006 Mellanox Technologies. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef IB_USER_VERBS_H #define IB_USER_VERBS_H #include <linux/types.h> /* * Increment this value if any changes that break userspace ABI * compatibility are made. */ #define IB_USER_VERBS_ABI_VERSION 6 #define IB_USER_VERBS_CMD_THRESHOLD 50 enum ib_uverbs_write_cmds { IB_USER_VERBS_CMD_GET_CONTEXT, IB_USER_VERBS_CMD_QUERY_DEVICE, IB_USER_VERBS_CMD_QUERY_PORT, IB_USER_VERBS_CMD_ALLOC_PD, IB_USER_VERBS_CMD_DEALLOC_PD, IB_USER_VERBS_CMD_CREATE_AH, IB_USER_VERBS_CMD_MODIFY_AH, IB_USER_VERBS_CMD_QUERY_AH, IB_USER_VERBS_CMD_DESTROY_AH, IB_USER_VERBS_CMD_REG_MR, IB_USER_VERBS_CMD_REG_SMR, IB_USER_VERBS_CMD_REREG_MR, IB_USER_VERBS_CMD_QUERY_MR, IB_USER_VERBS_CMD_DEREG_MR, IB_USER_VERBS_CMD_ALLOC_MW, IB_USER_VERBS_CMD_BIND_MW, IB_USER_VERBS_CMD_DEALLOC_MW, IB_USER_VERBS_CMD_CREATE_COMP_CHANNEL, IB_USER_VERBS_CMD_CREATE_CQ, IB_USER_VERBS_CMD_RESIZE_CQ, IB_USER_VERBS_CMD_DESTROY_CQ, IB_USER_VERBS_CMD_POLL_CQ, IB_USER_VERBS_CMD_PEEK_CQ, IB_USER_VERBS_CMD_REQ_NOTIFY_CQ, IB_USER_VERBS_CMD_CREATE_QP, IB_USER_VERBS_CMD_QUERY_QP, IB_USER_VERBS_CMD_MODIFY_QP, IB_USER_VERBS_CMD_DESTROY_QP, IB_USER_VERBS_CMD_POST_SEND, IB_USER_VERBS_CMD_POST_RECV, IB_USER_VERBS_CMD_ATTACH_MCAST, IB_USER_VERBS_CMD_DETACH_MCAST, IB_USER_VERBS_CMD_CREATE_SRQ, IB_USER_VERBS_CMD_MODIFY_SRQ, IB_USER_VERBS_CMD_QUERY_SRQ, IB_USER_VERBS_CMD_DESTROY_SRQ, IB_USER_VERBS_CMD_POST_SRQ_RECV, IB_USER_VERBS_CMD_OPEN_XRCD, IB_USER_VERBS_CMD_CLOSE_XRCD, IB_USER_VERBS_CMD_CREATE_XSRQ, IB_USER_VERBS_CMD_OPEN_QP, }; enum { IB_USER_VERBS_EX_CMD_QUERY_DEVICE = IB_USER_VERBS_CMD_QUERY_DEVICE, IB_USER_VERBS_EX_CMD_CREATE_CQ = IB_USER_VERBS_CMD_CREATE_CQ, IB_USER_VERBS_EX_CMD_CREATE_QP = IB_USER_VERBS_CMD_CREATE_QP, IB_USER_VERBS_EX_CMD_MODIFY_QP = IB_USER_VERBS_CMD_MODIFY_QP, IB_USER_VERBS_EX_CMD_CREATE_FLOW = IB_USER_VERBS_CMD_THRESHOLD, IB_USER_VERBS_EX_CMD_DESTROY_FLOW, IB_USER_VERBS_EX_CMD_CREATE_WQ, IB_USER_VERBS_EX_CMD_MODIFY_WQ, IB_USER_VERBS_EX_CMD_DESTROY_WQ, IB_USER_VERBS_EX_CMD_CREATE_RWQ_IND_TBL, IB_USER_VERBS_EX_CMD_DESTROY_RWQ_IND_TBL, IB_USER_VERBS_EX_CMD_MODIFY_CQ }; /* see IBA A19.4.1.1 Placement Types */ enum ib_placement_type { IB_FLUSH_GLOBAL = 1U << 0, IB_FLUSH_PERSISTENT = 1U << 1, }; /* see IBA A19.4.1.2 Selectivity Level */ enum ib_selectivity_level { IB_FLUSH_RANGE = 0, IB_FLUSH_MR, }; /* * Make sure that all structs defined in this file remain laid out so * that they pack the same way on 32-bit and 64-bit architectures (to * avoid incompatibility between 32-bit userspace and 64-bit kernels). * Specifically: * - Do not use pointer types -- pass pointers in __u64 instead. * - Make sure that any structure larger than 4 bytes is padded to a * multiple of 8 bytes. Otherwise the structure size will be * different between 32-bit and 64-bit architectures. */ struct ib_uverbs_async_event_desc { __aligned_u64 element; __u32 event_type; /* enum ib_event_type */ __u32 reserved; }; struct ib_uverbs_comp_event_desc { __aligned_u64 cq_handle; }; struct ib_uverbs_cq_moderation_caps { __u16 max_cq_moderation_count; __u16 max_cq_moderation_period; __u32 reserved; }; /* * All commands from userspace should start with a __u32 command field * followed by __u16 in_words and out_words fields (which give the * length of the command block and response buffer if any in 32-bit * words). The kernel driver will read these fields first and read * the rest of the command struct based on these value. */ #define IB_USER_VERBS_CMD_COMMAND_MASK 0xff #define IB_USER_VERBS_CMD_FLAG_EXTENDED 0x80000000u struct ib_uverbs_cmd_hdr { __u32 command; __u16 in_words; __u16 out_words; }; struct ib_uverbs_ex_cmd_hdr { __aligned_u64 response; __u16 provider_in_words; __u16 provider_out_words; __u32 cmd_hdr_reserved; }; struct ib_uverbs_get_context { __aligned_u64 response; __aligned_u64 driver_data[]; }; struct ib_uverbs_get_context_resp { __u32 async_fd; __u32 num_comp_vectors; __aligned_u64 driver_data[]; }; struct ib_uverbs_query_device { __aligned_u64 response; __aligned_u64 driver_data[]; }; struct ib_uverbs_query_device_resp { __aligned_u64 fw_ver; __be64 node_guid; __be64 sys_image_guid; __aligned_u64 max_mr_size; __aligned_u64 page_size_cap; __u32 vendor_id; __u32 vendor_part_id; __u32 hw_ver; __u32 max_qp; __u32 max_qp_wr; __u32 device_cap_flags; __u32 max_sge; __u32 max_sge_rd; __u32 max_cq; __u32 max_cqe; __u32 max_mr; __u32 max_pd; __u32 max_qp_rd_atom; __u32 max_ee_rd_atom; __u32 max_res_rd_atom; __u32 max_qp_init_rd_atom; __u32 max_ee_init_rd_atom; __u32 atomic_cap; __u32 max_ee; __u32 max_rdd; __u32 max_mw; __u32 max_raw_ipv6_qp; __u32 max_raw_ethy_qp; __u32 max_mcast_grp; __u32 max_mcast_qp_attach; __u32 max_total_mcast_qp_attach; __u32 max_ah; __u32 max_fmr; __u32 max_map_per_fmr; __u32 max_srq; __u32 max_srq_wr; __u32 max_srq_sge; __u16 max_pkeys; __u8 local_ca_ack_delay; __u8 phys_port_cnt; __u8 reserved[4]; }; struct ib_uverbs_ex_query_device { __u32 comp_mask; __u32 reserved; }; struct ib_uverbs_odp_caps { __aligned_u64 general_caps; struct { __u32 rc_odp_caps; __u32 uc_odp_caps; __u32 ud_odp_caps; } per_transport_caps; __u32 reserved; }; struct ib_uverbs_rss_caps { /* Corresponding bit will be set if qp type from * 'enum ib_qp_type' is supported, e.g. * supported_qpts |= 1 << IB_QPT_UD */ __u32 supported_qpts; __u32 max_rwq_indirection_tables; __u32 max_rwq_indirection_table_size; __u32 reserved; }; struct ib_uverbs_tm_caps { /* Max size of rendezvous request message */ __u32 max_rndv_hdr_size; /* Max number of entries in tag matching list */ __u32 max_num_tags; /* TM flags */ __u32 flags; /* Max number of outstanding list operations */ __u32 max_ops; /* Max number of SGE in tag matching entry */ __u32 max_sge; __u32 reserved; }; struct ib_uverbs_ex_query_device_resp { struct ib_uverbs_query_device_resp base; __u32 comp_mask; __u32 response_length; struct ib_uverbs_odp_caps odp_caps; __aligned_u64 timestamp_mask; __aligned_u64 hca_core_clock; /* in KHZ */ __aligned_u64 device_cap_flags_ex; struct ib_uverbs_rss_caps rss_caps; __u32 max_wq_type_rq; __u32 raw_packet_caps; struct ib_uverbs_tm_caps tm_caps; struct ib_uverbs_cq_moderation_caps cq_moderation_caps; __aligned_u64 max_dm_size; __u32 xrc_odp_caps; __u32 reserved; }; struct ib_uverbs_query_port { __aligned_u64 response; __u8 port_num; __u8 reserved[7]; __aligned_u64 driver_data[]; }; struct ib_uverbs_query_port_resp { __u32 port_cap_flags; /* see ib_uverbs_query_port_cap_flags */ __u32 max_msg_sz; __u32 bad_pkey_cntr; __u32 qkey_viol_cntr; __u32 gid_tbl_len; __u16 pkey_tbl_len; __u16 lid; __u16 sm_lid; __u8 state; __u8 max_mtu; __u8 active_mtu; __u8 lmc; __u8 max_vl_num; __u8 sm_sl; __u8 subnet_timeout; __u8 init_type_reply; __u8 active_width; __u8 active_speed; __u8 phys_state; __u8 link_layer; __u8 flags; /* see ib_uverbs_query_port_flags */ __u8 reserved; }; struct ib_uverbs_alloc_pd { __aligned_u64 response; __aligned_u64 driver_data[]; }; struct ib_uverbs_alloc_pd_resp { __u32 pd_handle; __u32 driver_data[]; }; struct ib_uverbs_dealloc_pd { __u32 pd_handle; }; struct ib_uverbs_open_xrcd { __aligned_u64 response; __u32 fd; __u32 oflags; __aligned_u64 driver_data[]; }; struct ib_uverbs_open_xrcd_resp { __u32 xrcd_handle; __u32 driver_data[]; }; struct ib_uverbs_close_xrcd { __u32 xrcd_handle; }; struct ib_uverbs_reg_mr { __aligned_u64 response; __aligned_u64 start; __aligned_u64 length; __aligned_u64 hca_va; __u32 pd_handle; __u32 access_flags; __aligned_u64 driver_data[]; }; struct ib_uverbs_reg_mr_resp { __u32 mr_handle; __u32 lkey; __u32 rkey; __u32 driver_data[]; }; struct ib_uverbs_rereg_mr { __aligned_u64 response; __u32 mr_handle; __u32 flags; __aligned_u64 start; __aligned_u64 length; __aligned_u64 hca_va; __u32 pd_handle; __u32 access_flags; __aligned_u64 driver_data[]; }; struct ib_uverbs_rereg_mr_resp { __u32 lkey; __u32 rkey; __aligned_u64 driver_data[]; }; struct ib_uverbs_dereg_mr { __u32 mr_handle; }; struct ib_uverbs_alloc_mw { __aligned_u64 response; __u32 pd_handle; __u8 mw_type; __u8 reserved[3]; __aligned_u64 driver_data[]; }; struct ib_uverbs_alloc_mw_resp { __u32 mw_handle; __u32 rkey; __aligned_u64 driver_data[]; }; struct ib_uverbs_dealloc_mw { __u32 mw_handle; }; struct ib_uverbs_create_comp_channel { __aligned_u64 response; }; struct ib_uverbs_create_comp_channel_resp { __u32 fd; }; struct ib_uverbs_create_cq { __aligned_u64 response; __aligned_u64 user_handle; __u32 cqe; __u32 comp_vector; __s32 comp_channel; __u32 reserved; __aligned_u64 driver_data[]; }; enum ib_uverbs_ex_create_cq_flags { IB_UVERBS_CQ_FLAGS_TIMESTAMP_COMPLETION = 1 << 0, IB_UVERBS_CQ_FLAGS_IGNORE_OVERRUN = 1 << 1, }; struct ib_uverbs_ex_create_cq { __aligned_u64 user_handle; __u32 cqe; __u32 comp_vector; __s32 comp_channel; __u32 comp_mask; __u32 flags; /* bitmask of ib_uverbs_ex_create_cq_flags */ __u32 reserved; }; struct ib_uverbs_create_cq_resp { __u32 cq_handle; __u32 cqe; __aligned_u64 driver_data[0]; }; struct ib_uverbs_ex_create_cq_resp { struct ib_uverbs_create_cq_resp base; __u32 comp_mask; __u32 response_length; }; struct ib_uverbs_resize_cq { __aligned_u64 response; __u32 cq_handle; __u32 cqe; __aligned_u64 driver_data[]; }; struct ib_uverbs_resize_cq_resp { __u32 cqe; __u32 reserved; __aligned_u64 driver_data[]; }; struct ib_uverbs_poll_cq { __aligned_u64 response; __u32 cq_handle; __u32 ne; }; enum ib_uverbs_wc_opcode { IB_UVERBS_WC_SEND = 0, IB_UVERBS_WC_RDMA_WRITE = 1, IB_UVERBS_WC_RDMA_READ = 2, IB_UVERBS_WC_COMP_SWAP = 3, IB_UVERBS_WC_FETCH_ADD = 4, IB_UVERBS_WC_BIND_MW = 5, IB_UVERBS_WC_LOCAL_INV = 6, IB_UVERBS_WC_TSO = 7, IB_UVERBS_WC_FLUSH = 8, IB_UVERBS_WC_ATOMIC_WRITE = 9, }; struct ib_uverbs_wc { __aligned_u64 wr_id; __u32 status; __u32 opcode; __u32 vendor_err; __u32 byte_len; union { __be32 imm_data; __u32 invalidate_rkey; } ex; __u32 qp_num; __u32 src_qp; __u32 wc_flags; __u16 pkey_index; __u16 slid; __u8 sl; __u8 dlid_path_bits; __u8 port_num; __u8 reserved; }; struct ib_uverbs_poll_cq_resp { __u32 count; __u32 reserved; struct ib_uverbs_wc wc[]; }; struct ib_uverbs_req_notify_cq { __u32 cq_handle; __u32 solicited_only; }; struct ib_uverbs_destroy_cq { __aligned_u64 response; __u32 cq_handle; __u32 reserved; }; struct ib_uverbs_destroy_cq_resp { __u32 comp_events_reported; __u32 async_events_reported; }; struct ib_uverbs_global_route { __u8 dgid[16]; __u32 flow_label; __u8 sgid_index; __u8 hop_limit; __u8 traffic_class; __u8 reserved; }; struct ib_uverbs_ah_attr { struct ib_uverbs_global_route grh; __u16 dlid; __u8 sl; __u8 src_path_bits; __u8 static_rate; __u8 is_global; __u8 port_num; __u8 reserved; }; struct ib_uverbs_qp_attr { __u32 qp_attr_mask; __u32 qp_state; __u32 cur_qp_state; __u32 path_mtu; __u32 path_mig_state; __u32 qkey; __u32 rq_psn; __u32 sq_psn; __u32 dest_qp_num; __u32 qp_access_flags; struct ib_uverbs_ah_attr ah_attr; struct ib_uverbs_ah_attr alt_ah_attr; /* ib_qp_cap */ __u32 max_send_wr; __u32 max_recv_wr; __u32 max_send_sge; __u32 max_recv_sge; __u32 max_inline_data; __u16 pkey_index; __u16 alt_pkey_index; __u8 en_sqd_async_notify; __u8 sq_draining; __u8 max_rd_atomic; __u8 max_dest_rd_atomic; __u8 min_rnr_timer; __u8 port_num; __u8 timeout; __u8 retry_cnt; __u8 rnr_retry; __u8 alt_port_num; __u8 alt_timeout; __u8 reserved[5]; }; struct ib_uverbs_create_qp { __aligned_u64 response; __aligned_u64 user_handle; __u32 pd_handle; __u32 send_cq_handle; __u32 recv_cq_handle; __u32 srq_handle; __u32 max_send_wr; __u32 max_recv_wr; __u32 max_send_sge; __u32 max_recv_sge; __u32 max_inline_data; __u8 sq_sig_all; __u8 qp_type; __u8 is_srq; __u8 reserved; __aligned_u64 driver_data[]; }; enum ib_uverbs_create_qp_mask { IB_UVERBS_CREATE_QP_MASK_IND_TABLE = 1UL << 0, }; enum { IB_UVERBS_CREATE_QP_SUP_COMP_MASK = IB_UVERBS_CREATE_QP_MASK_IND_TABLE, }; struct ib_uverbs_ex_create_qp { __aligned_u64 user_handle; __u32 pd_handle; __u32 send_cq_handle; __u32 recv_cq_handle; __u32 srq_handle; __u32 max_send_wr; __u32 max_recv_wr; __u32 max_send_sge; __u32 max_recv_sge; __u32 max_inline_data; __u8 sq_sig_all; __u8 qp_type; __u8 is_srq; __u8 reserved; __u32 comp_mask; __u32 create_flags; __u32 rwq_ind_tbl_handle; __u32 source_qpn; }; struct ib_uverbs_open_qp { __aligned_u64 response; __aligned_u64 user_handle; __u32 pd_handle; __u32 qpn; __u8 qp_type; __u8 reserved[7]; __aligned_u64 driver_data[]; }; /* also used for open response */ struct ib_uverbs_create_qp_resp { __u32 qp_handle; __u32 qpn; __u32 max_send_wr; __u32 max_recv_wr; __u32 max_send_sge; __u32 max_recv_sge; __u32 max_inline_data; __u32 reserved; __u32 driver_data[0]; }; struct ib_uverbs_ex_create_qp_resp { struct ib_uverbs_create_qp_resp base; __u32 comp_mask; __u32 response_length; }; /* * This struct needs to remain a multiple of 8 bytes to keep the * alignment of the modify QP parameters. */ struct ib_uverbs_qp_dest { __u8 dgid[16]; __u32 flow_label; __u16 dlid; __u16 reserved; __u8 sgid_index; __u8 hop_limit; __u8 traffic_class; __u8 sl; __u8 src_path_bits; __u8 static_rate; __u8 is_global; __u8 port_num; }; struct ib_uverbs_query_qp { __aligned_u64 response; __u32 qp_handle; __u32 attr_mask; __aligned_u64 driver_data[]; }; struct ib_uverbs_query_qp_resp { struct ib_uverbs_qp_dest dest; struct ib_uverbs_qp_dest alt_dest; __u32 max_send_wr; __u32 max_recv_wr; __u32 max_send_sge; __u32 max_recv_sge; __u32 max_inline_data; __u32 qkey; __u32 rq_psn; __u32 sq_psn; __u32 dest_qp_num; __u32 qp_access_flags; __u16 pkey_index; __u16 alt_pkey_index; __u8 qp_state; __u8 cur_qp_state; __u8 path_mtu; __u8 path_mig_state; __u8 sq_draining; __u8 max_rd_atomic; __u8 max_dest_rd_atomic; __u8 min_rnr_timer; __u8 port_num; __u8 timeout; __u8 retry_cnt; __u8 rnr_retry; __u8 alt_port_num; __u8 alt_timeout; __u8 sq_sig_all; __u8 reserved[5]; __aligned_u64 driver_data[]; }; struct ib_uverbs_modify_qp { struct ib_uverbs_qp_dest dest; struct ib_uverbs_qp_dest alt_dest; __u32 qp_handle; __u32 attr_mask; __u32 qkey; __u32 rq_psn; __u32 sq_psn; __u32 dest_qp_num; __u32 qp_access_flags; __u16 pkey_index; __u16 alt_pkey_index; __u8 qp_state; __u8 cur_qp_state; __u8 path_mtu; __u8 path_mig_state; __u8 en_sqd_async_notify; __u8 max_rd_atomic; __u8 max_dest_rd_atomic; __u8 min_rnr_timer; __u8 port_num; __u8 timeout; __u8 retry_cnt; __u8 rnr_retry; __u8 alt_port_num; __u8 alt_timeout; __u8 reserved[2]; __aligned_u64 driver_data[0]; }; struct ib_uverbs_ex_modify_qp { struct ib_uverbs_modify_qp base; __u32 rate_limit; __u32 reserved; }; struct ib_uverbs_ex_modify_qp_resp { __u32 comp_mask; __u32 response_length; }; struct ib_uverbs_destroy_qp { __aligned_u64 response; __u32 qp_handle; __u32 reserved; }; struct ib_uverbs_destroy_qp_resp { __u32 events_reported; }; /* * The ib_uverbs_sge structure isn't used anywhere, since we assume * the ib_sge structure is packed the same way on 32-bit and 64-bit * architectures in both kernel and user space. It's just here to * document the ABI. */ struct ib_uverbs_sge { __aligned_u64 addr; __u32 length; __u32 lkey; }; enum ib_uverbs_wr_opcode { IB_UVERBS_WR_RDMA_WRITE = 0, IB_UVERBS_WR_RDMA_WRITE_WITH_IMM = 1, IB_UVERBS_WR_SEND = 2, IB_UVERBS_WR_SEND_WITH_IMM = 3, IB_UVERBS_WR_RDMA_READ = 4, IB_UVERBS_WR_ATOMIC_CMP_AND_SWP = 5, IB_UVERBS_WR_ATOMIC_FETCH_AND_ADD = 6, IB_UVERBS_WR_LOCAL_INV = 7, IB_UVERBS_WR_BIND_MW = 8, IB_UVERBS_WR_SEND_WITH_INV = 9, IB_UVERBS_WR_TSO = 10, IB_UVERBS_WR_RDMA_READ_WITH_INV = 11, IB_UVERBS_WR_MASKED_ATOMIC_CMP_AND_SWP = 12, IB_UVERBS_WR_MASKED_ATOMIC_FETCH_AND_ADD = 13, IB_UVERBS_WR_FLUSH = 14, IB_UVERBS_WR_ATOMIC_WRITE = 15, /* Review enum ib_wr_opcode before modifying this */ }; struct ib_uverbs_send_wr { __aligned_u64 wr_id; __u32 num_sge; __u32 opcode; /* see enum ib_uverbs_wr_opcode */ __u32 send_flags; union { __be32 imm_data; __u32 invalidate_rkey; } ex; union { struct { __aligned_u64 remote_addr; __u32 rkey; __u32 reserved; } rdma; struct { __aligned_u64 remote_addr; __aligned_u64 compare_add; __aligned_u64 swap; __u32 rkey; __u32 reserved; } atomic; struct { __u32 ah; __u32 remote_qpn; __u32 remote_qkey; __u32 reserved; } ud; } wr; }; struct ib_uverbs_post_send { __aligned_u64 response; __u32 qp_handle; __u32 wr_count; __u32 sge_count; __u32 wqe_size; struct ib_uverbs_send_wr send_wr[]; }; struct ib_uverbs_post_send_resp { __u32 bad_wr; }; struct ib_uverbs_recv_wr { __aligned_u64 wr_id; __u32 num_sge; __u32 reserved; }; struct ib_uverbs_post_recv { __aligned_u64 response; __u32 qp_handle; __u32 wr_count; __u32 sge_count; __u32 wqe_size; struct ib_uverbs_recv_wr recv_wr[]; }; struct ib_uverbs_post_recv_resp { __u32 bad_wr; }; struct ib_uverbs_post_srq_recv { __aligned_u64 response; __u32 srq_handle; __u32 wr_count; __u32 sge_count; __u32 wqe_size; struct ib_uverbs_recv_wr recv[]; }; struct ib_uverbs_post_srq_recv_resp { __u32 bad_wr; }; struct ib_uverbs_create_ah { __aligned_u64 response; __aligned_u64 user_handle; __u32 pd_handle; __u32 reserved; struct ib_uverbs_ah_attr attr; __aligned_u64 driver_data[]; }; struct ib_uverbs_create_ah_resp { __u32 ah_handle; __u32 driver_data[]; }; struct ib_uverbs_destroy_ah { __u32 ah_handle; }; struct ib_uverbs_attach_mcast { __u8 gid[16]; __u32 qp_handle; __u16 mlid; __u16 reserved; __aligned_u64 driver_data[]; }; struct ib_uverbs_detach_mcast { __u8 gid[16]; __u32 qp_handle; __u16 mlid; __u16 reserved; __aligned_u64 driver_data[]; }; struct ib_uverbs_flow_spec_hdr { __u32 type; __u16 size; __u16 reserved; /* followed by flow_spec */ __aligned_u64 flow_spec_data[0]; }; struct ib_uverbs_flow_eth_filter { __u8 dst_mac[6]; __u8 src_mac[6]; __be16 ether_type; __be16 vlan_tag; }; struct ib_uverbs_flow_spec_eth { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_eth_filter val; struct ib_uverbs_flow_eth_filter mask; }; struct ib_uverbs_flow_ipv4_filter { __be32 src_ip; __be32 dst_ip; __u8 proto; __u8 tos; __u8 ttl; __u8 flags; }; struct ib_uverbs_flow_spec_ipv4 { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_ipv4_filter val; struct ib_uverbs_flow_ipv4_filter mask; }; struct ib_uverbs_flow_tcp_udp_filter { __be16 dst_port; __be16 src_port; }; struct ib_uverbs_flow_spec_tcp_udp { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_tcp_udp_filter val; struct ib_uverbs_flow_tcp_udp_filter mask; }; struct ib_uverbs_flow_ipv6_filter { __u8 src_ip[16]; __u8 dst_ip[16]; __be32 flow_label; __u8 next_hdr; __u8 traffic_class; __u8 hop_limit; __u8 reserved; }; struct ib_uverbs_flow_spec_ipv6 { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_ipv6_filter val; struct ib_uverbs_flow_ipv6_filter mask; }; struct ib_uverbs_flow_spec_action_tag { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; __u32 tag_id; __u32 reserved1; }; struct ib_uverbs_flow_spec_action_drop { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; }; struct ib_uverbs_flow_spec_action_handle { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; __u32 handle; __u32 reserved1; }; struct ib_uverbs_flow_spec_action_count { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; __u32 handle; __u32 reserved1; }; struct ib_uverbs_flow_tunnel_filter { __be32 tunnel_id; }; struct ib_uverbs_flow_spec_tunnel { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_tunnel_filter val; struct ib_uverbs_flow_tunnel_filter mask; }; struct ib_uverbs_flow_spec_esp_filter { __u32 spi; __u32 seq; }; struct ib_uverbs_flow_spec_esp { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_spec_esp_filter val; struct ib_uverbs_flow_spec_esp_filter mask; }; struct ib_uverbs_flow_gre_filter { /* c_ks_res0_ver field is bits 0-15 in offset 0 of a standard GRE header: * bit 0 - C - checksum bit. * bit 1 - reserved. set to 0. * bit 2 - key bit. * bit 3 - sequence number bit. * bits 4:12 - reserved. set to 0. * bits 13:15 - GRE version. */ __be16 c_ks_res0_ver; __be16 protocol; __be32 key; }; struct ib_uverbs_flow_spec_gre { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_gre_filter val; struct ib_uverbs_flow_gre_filter mask; }; struct ib_uverbs_flow_mpls_filter { /* The field includes the entire MPLS label: * bits 0:19 - label field. * bits 20:22 - traffic class field. * bits 23 - bottom of stack bit. * bits 24:31 - ttl field. */ __be32 label; }; struct ib_uverbs_flow_spec_mpls { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_mpls_filter val; struct ib_uverbs_flow_mpls_filter mask; }; struct ib_uverbs_flow_attr { __u32 type; __u16 size; __u16 priority; __u8 num_of_specs; __u8 reserved[2]; __u8 port; __u32 flags; /* Following are the optional layers according to user request * struct ib_flow_spec_xxx * struct ib_flow_spec_yyy */ struct ib_uverbs_flow_spec_hdr flow_specs[]; }; struct ib_uverbs_create_flow { __u32 comp_mask; __u32 qp_handle; struct ib_uverbs_flow_attr flow_attr; }; struct ib_uverbs_create_flow_resp { __u32 comp_mask; __u32 flow_handle; }; struct ib_uverbs_destroy_flow { __u32 comp_mask; __u32 flow_handle; }; struct ib_uverbs_create_srq { __aligned_u64 response; __aligned_u64 user_handle; __u32 pd_handle; __u32 max_wr; __u32 max_sge; __u32 srq_limit; __aligned_u64 driver_data[]; }; struct ib_uverbs_create_xsrq { __aligned_u64 response; __aligned_u64 user_handle; __u32 srq_type; __u32 pd_handle; __u32 max_wr; __u32 max_sge; __u32 srq_limit; __u32 max_num_tags; __u32 xrcd_handle; __u32 cq_handle; __aligned_u64 driver_data[]; }; struct ib_uverbs_create_srq_resp { __u32 srq_handle; __u32 max_wr; __u32 max_sge; __u32 srqn; __u32 driver_data[]; }; struct ib_uverbs_modify_srq { __u32 srq_handle; __u32 attr_mask; __u32 max_wr; __u32 srq_limit; __aligned_u64 driver_data[]; }; struct ib_uverbs_query_srq { __aligned_u64 response; __u32 srq_handle; __u32 reserved; __aligned_u64 driver_data[]; }; struct ib_uverbs_query_srq_resp { __u32 max_wr; __u32 max_sge; __u32 srq_limit; __u32 reserved; }; struct ib_uverbs_destroy_srq { __aligned_u64 response; __u32 srq_handle; __u32 reserved; }; struct ib_uverbs_destroy_srq_resp { __u32 events_reported; }; struct ib_uverbs_ex_create_wq { __u32 comp_mask; __u32 wq_type; __aligned_u64 user_handle; __u32 pd_handle; __u32 cq_handle; __u32 max_wr; __u32 max_sge; __u32 create_flags; /* Use enum ib_wq_flags */ __u32 reserved; }; struct ib_uverbs_ex_create_wq_resp { __u32 comp_mask; __u32 response_length; __u32 wq_handle; __u32 max_wr; __u32 max_sge; __u32 wqn; }; struct ib_uverbs_ex_destroy_wq { __u32 comp_mask; __u32 wq_handle; }; struct ib_uverbs_ex_destroy_wq_resp { __u32 comp_mask; __u32 response_length; __u32 events_reported; __u32 reserved; }; struct ib_uverbs_ex_modify_wq { __u32 attr_mask; __u32 wq_handle; __u32 wq_state; __u32 curr_wq_state; __u32 flags; /* Use enum ib_wq_flags */ __u32 flags_mask; /* Use enum ib_wq_flags */ }; /* Prevent memory allocation rather than max expected size */ #define IB_USER_VERBS_MAX_LOG_IND_TBL_SIZE 0x0d struct ib_uverbs_ex_create_rwq_ind_table { __u32 comp_mask; __u32 log_ind_tbl_size; /* Following are the wq handles according to log_ind_tbl_size * wq_handle1 * wq_handle2 */ __u32 wq_handles[]; }; struct ib_uverbs_ex_create_rwq_ind_table_resp { __u32 comp_mask; __u32 response_length; __u32 ind_tbl_handle; __u32 ind_tbl_num; }; struct ib_uverbs_ex_destroy_rwq_ind_table { __u32 comp_mask; __u32 ind_tbl_handle; }; struct ib_uverbs_cq_moderation { __u16 cq_count; __u16 cq_period; }; struct ib_uverbs_ex_modify_cq { __u32 cq_handle; __u32 attr_mask; struct ib_uverbs_cq_moderation attr; __u32 reserved; }; #define IB_DEVICE_NAME_MAX 64 /* * bits 9, 15, 16, 19, 22, 27, 30, 31, 32, 33, 35 and 37 may be set by old * kernels and should not be used. */ enum ib_uverbs_device_cap_flags { IB_UVERBS_DEVICE_RESIZE_MAX_WR = 1 << 0, IB_UVERBS_DEVICE_BAD_PKEY_CNTR = 1 << 1, IB_UVERBS_DEVICE_BAD_QKEY_CNTR = 1 << 2, IB_UVERBS_DEVICE_RAW_MULTI = 1 << 3, IB_UVERBS_DEVICE_AUTO_PATH_MIG = 1 << 4, IB_UVERBS_DEVICE_CHANGE_PHY_PORT = 1 << 5, IB_UVERBS_DEVICE_UD_AV_PORT_ENFORCE = 1 << 6, IB_UVERBS_DEVICE_CURR_QP_STATE_MOD = 1 << 7, IB_UVERBS_DEVICE_SHUTDOWN_PORT = 1 << 8, /* IB_UVERBS_DEVICE_INIT_TYPE = 1 << 9, (not in use) */ IB_UVERBS_DEVICE_PORT_ACTIVE_EVENT = 1 << 10, IB_UVERBS_DEVICE_SYS_IMAGE_GUID = 1 << 11, IB_UVERBS_DEVICE_RC_RNR_NAK_GEN = 1 << 12, IB_UVERBS_DEVICE_SRQ_RESIZE = 1 << 13, IB_UVERBS_DEVICE_N_NOTIFY_CQ = 1 << 14, IB_UVERBS_DEVICE_MEM_WINDOW = 1 << 17, IB_UVERBS_DEVICE_UD_IP_CSUM = 1 << 18, IB_UVERBS_DEVICE_XRC = 1 << 20, IB_UVERBS_DEVICE_MEM_MGT_EXTENSIONS = 1 << 21, IB_UVERBS_DEVICE_MEM_WINDOW_TYPE_2A = 1 << 23, IB_UVERBS_DEVICE_MEM_WINDOW_TYPE_2B = 1 << 24, IB_UVERBS_DEVICE_RC_IP_CSUM = 1 << 25, /* Deprecated. Please use IB_UVERBS_RAW_PACKET_CAP_IP_CSUM. */ IB_UVERBS_DEVICE_RAW_IP_CSUM = 1 << 26, IB_UVERBS_DEVICE_MANAGED_FLOW_STEERING = 1 << 29, /* Deprecated. Please use IB_UVERBS_RAW_PACKET_CAP_SCATTER_FCS. */ IB_UVERBS_DEVICE_RAW_SCATTER_FCS = 1ULL << 34, IB_UVERBS_DEVICE_PCI_WRITE_END_PADDING = 1ULL << 36, /* Flush placement types */ IB_UVERBS_DEVICE_FLUSH_GLOBAL = 1ULL << 38, IB_UVERBS_DEVICE_FLUSH_PERSISTENT = 1ULL << 39, /* Atomic write attributes */ IB_UVERBS_DEVICE_ATOMIC_WRITE = 1ULL << 40, }; enum ib_uverbs_raw_packet_caps { IB_UVERBS_RAW_PACKET_CAP_CVLAN_STRIPPING = 1 << 0, IB_UVERBS_RAW_PACKET_CAP_SCATTER_FCS = 1 << 1, IB_UVERBS_RAW_PACKET_CAP_IP_CSUM = 1 << 2, IB_UVERBS_RAW_PACKET_CAP_DELAY_DROP = 1 << 3, }; #endif /* IB_USER_VERBS_H */ irdma-abi.h000064400000004220151703010350006533 0ustar00/* SPDX-License-Identifier: (GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB */ /* * Copyright (c) 2006 - 2021 Intel Corporation. All rights reserved. * Copyright (c) 2005 Topspin Communications. All rights reserved. * Copyright (c) 2005 Cisco Systems. All rights reserved. * Copyright (c) 2005 Open Grid Computing, Inc. All rights reserved. */ #ifndef IRDMA_ABI_H #define IRDMA_ABI_H #include <linux/types.h> /* irdma must support legacy GEN_1 i40iw kernel * and user-space whose last ABI ver is 5 */ #define IRDMA_ABI_VER 5 enum irdma_memreg_type { IRDMA_MEMREG_TYPE_MEM = 0, IRDMA_MEMREG_TYPE_QP = 1, IRDMA_MEMREG_TYPE_CQ = 2, }; struct irdma_alloc_ucontext_req { __u32 rsvd32; __u8 userspace_ver; __u8 rsvd8[3]; }; struct irdma_alloc_ucontext_resp { __u32 max_pds; __u32 max_qps; __u32 wq_size; /* size of the WQs (SQ+RQ) in the mmaped area */ __u8 kernel_ver; __u8 rsvd[3]; __aligned_u64 feature_flags; __aligned_u64 db_mmap_key; __u32 max_hw_wq_frags; __u32 max_hw_read_sges; __u32 max_hw_inline; __u32 max_hw_rq_quanta; __u32 max_hw_wq_quanta; __u32 min_hw_cq_size; __u32 max_hw_cq_size; __u16 max_hw_sq_chunk; __u8 hw_rev; __u8 rsvd2; }; struct irdma_alloc_pd_resp { __u32 pd_id; __u8 rsvd[4]; }; struct irdma_resize_cq_req { __aligned_u64 user_cq_buffer; }; struct irdma_create_cq_req { __aligned_u64 user_cq_buf; __aligned_u64 user_shadow_area; }; struct irdma_create_qp_req { __aligned_u64 user_wqe_bufs; __aligned_u64 user_compl_ctx; }; struct irdma_mem_reg_req { __u16 reg_type; /* enum irdma_memreg_type */ __u16 cq_pages; __u16 rq_pages; __u16 sq_pages; }; struct irdma_modify_qp_req { __u8 sq_flush; __u8 rq_flush; __u8 rsvd[6]; }; struct irdma_create_cq_resp { __u32 cq_id; __u32 cq_size; }; struct irdma_create_qp_resp { __u32 qp_id; __u32 actual_sq_size; __u32 actual_rq_size; __u32 irdma_drv_opt; __u16 push_idx; __u8 lsmm; __u8 rsvd; __u32 qp_caps; }; struct irdma_modify_qp_resp { __aligned_u64 push_wqe_mmap_key; __aligned_u64 push_db_mmap_key; __u16 push_offset; __u8 push_valid; __u8 rsvd[5]; }; struct irdma_create_ah_resp { __u32 ah_id; __u8 rsvd[4]; }; #endif /* IRDMA_ABI_H */ mana-abi.h000064400000002241151703010350006354 0ustar00/* SPDX-License-Identifier: (GPL-2.0 WITH Linux-syscall-note) */ /* * Copyright (c) 2022, Microsoft Corporation. All rights reserved. */ #ifndef MANA_ABI_USER_H #define MANA_ABI_USER_H #include <linux/types.h> #include <rdma/ib_user_ioctl_verbs.h> /* * Increment this value if any changes that break userspace ABI * compatibility are made. */ #define MANA_IB_UVERBS_ABI_VERSION 1 struct mana_ib_create_cq { __aligned_u64 buf_addr; }; struct mana_ib_create_qp { __aligned_u64 sq_buf_addr; __u32 sq_buf_size; __u32 port; }; struct mana_ib_create_qp_resp { __u32 sqid; __u32 cqid; __u32 tx_vp_offset; __u32 reserved; }; struct mana_ib_create_wq { __aligned_u64 wq_buf_addr; __u32 wq_buf_size; __u32 reserved; }; /* RX Hash function flags */ enum mana_ib_rx_hash_function_flags { MANA_IB_RX_HASH_FUNC_TOEPLITZ = 1 << 0, }; struct mana_ib_create_qp_rss { __aligned_u64 rx_hash_fields_mask; __u8 rx_hash_function; __u8 reserved[7]; __u32 rx_hash_key_len; __u8 rx_hash_key[40]; __u32 port; }; struct rss_resp_entry { __u32 cqid; __u32 wqid; }; struct mana_ib_create_qp_rss_resp { __aligned_u64 num_entries; struct rss_resp_entry entries[64]; }; #endif mlx4-abi.h000064400000011775151703010350006340 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2007 Cisco Systems, Inc. All rights reserved. * Copyright (c) 2007, 2008 Mellanox Technologies. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef MLX4_ABI_USER_H #define MLX4_ABI_USER_H #include <linux/types.h> /* * Increment this value if any changes that break userspace ABI * compatibility are made. */ #define MLX4_IB_UVERBS_NO_DEV_CAPS_ABI_VERSION 3 #define MLX4_IB_UVERBS_ABI_VERSION 4 /* * Make sure that all structs defined in this file remain laid out so * that they pack the same way on 32-bit and 64-bit architectures (to * avoid incompatibility between 32-bit userspace and 64-bit kernels). * In particular do not use pointer types -- pass pointers in __u64 * instead. */ struct mlx4_ib_alloc_ucontext_resp_v3 { __u32 qp_tab_size; __u16 bf_reg_size; __u16 bf_regs_per_page; }; enum { MLX4_USER_DEV_CAP_LARGE_CQE = 1L << 0, }; struct mlx4_ib_alloc_ucontext_resp { __u32 dev_caps; __u32 qp_tab_size; __u16 bf_reg_size; __u16 bf_regs_per_page; __u32 cqe_size; }; struct mlx4_ib_alloc_pd_resp { __u32 pdn; __u32 reserved; }; struct mlx4_ib_create_cq { __aligned_u64 buf_addr; __aligned_u64 db_addr; }; struct mlx4_ib_create_cq_resp { __u32 cqn; __u32 reserved; }; struct mlx4_ib_resize_cq { __aligned_u64 buf_addr; }; struct mlx4_ib_create_srq { __aligned_u64 buf_addr; __aligned_u64 db_addr; }; struct mlx4_ib_create_srq_resp { __u32 srqn; __u32 reserved; }; struct mlx4_ib_create_qp_rss { __aligned_u64 rx_hash_fields_mask; /* Use enum mlx4_ib_rx_hash_fields */ __u8 rx_hash_function; /* Use enum mlx4_ib_rx_hash_function_flags */ __u8 reserved[7]; __u8 rx_hash_key[40]; __u32 comp_mask; __u32 reserved1; }; struct mlx4_ib_create_qp { __aligned_u64 buf_addr; __aligned_u64 db_addr; __u8 log_sq_bb_count; __u8 log_sq_stride; __u8 sq_no_prefetch; __u8 reserved; __u32 inl_recv_sz; }; struct mlx4_ib_create_wq { __aligned_u64 buf_addr; __aligned_u64 db_addr; __u8 log_range_size; __u8 reserved[3]; __u32 comp_mask; }; struct mlx4_ib_modify_wq { __u32 comp_mask; __u32 reserved; }; struct mlx4_ib_create_rwq_ind_tbl_resp { __u32 response_length; __u32 reserved; }; /* RX Hash function flags */ enum mlx4_ib_rx_hash_function_flags { MLX4_IB_RX_HASH_FUNC_TOEPLITZ = 1 << 0, }; /* * RX Hash flags, these flags allows to set which incoming packet's field should * participates in RX Hash. Each flag represent certain packet's field, * when the flag is set the field that is represented by the flag will * participate in RX Hash calculation. */ enum mlx4_ib_rx_hash_fields { MLX4_IB_RX_HASH_SRC_IPV4 = 1 << 0, MLX4_IB_RX_HASH_DST_IPV4 = 1 << 1, MLX4_IB_RX_HASH_SRC_IPV6 = 1 << 2, MLX4_IB_RX_HASH_DST_IPV6 = 1 << 3, MLX4_IB_RX_HASH_SRC_PORT_TCP = 1 << 4, MLX4_IB_RX_HASH_DST_PORT_TCP = 1 << 5, MLX4_IB_RX_HASH_SRC_PORT_UDP = 1 << 6, MLX4_IB_RX_HASH_DST_PORT_UDP = 1 << 7, MLX4_IB_RX_HASH_INNER = 1ULL << 31, }; struct mlx4_ib_rss_caps { __aligned_u64 rx_hash_fields_mask; /* enum mlx4_ib_rx_hash_fields */ __u8 rx_hash_function; /* enum mlx4_ib_rx_hash_function_flags */ __u8 reserved[7]; }; enum query_device_resp_mask { MLX4_IB_QUERY_DEV_RESP_MASK_CORE_CLOCK_OFFSET = 1UL << 0, }; struct mlx4_ib_tso_caps { __u32 max_tso; /* Maximum tso payload size in bytes */ /* Corresponding bit will be set if qp type from * 'enum ib_qp_type' is supported. */ __u32 supported_qpts; }; struct mlx4_uverbs_ex_query_device_resp { __u32 comp_mask; __u32 response_length; __aligned_u64 hca_core_clock_offset; __u32 max_inl_recv_sz; __u32 reserved; struct mlx4_ib_rss_caps rss_caps; struct mlx4_ib_tso_caps tso_caps; }; #endif /* MLX4_ABI_USER_H */ mlx5-abi.h000064400000033055151703010350006334 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2013-2015, Mellanox Technologies. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef MLX5_ABI_USER_H #define MLX5_ABI_USER_H #include <linux/types.h> #include <linux/if_ether.h> /* For ETH_ALEN. */ #include <rdma/ib_user_ioctl_verbs.h> enum { MLX5_QP_FLAG_SIGNATURE = 1 << 0, MLX5_QP_FLAG_SCATTER_CQE = 1 << 1, MLX5_QP_FLAG_TUNNEL_OFFLOADS = 1 << 2, MLX5_QP_FLAG_BFREG_INDEX = 1 << 3, MLX5_QP_FLAG_TYPE_DCT = 1 << 4, MLX5_QP_FLAG_TYPE_DCI = 1 << 5, MLX5_QP_FLAG_TIR_ALLOW_SELF_LB_UC = 1 << 6, MLX5_QP_FLAG_TIR_ALLOW_SELF_LB_MC = 1 << 7, MLX5_QP_FLAG_ALLOW_SCATTER_CQE = 1 << 8, MLX5_QP_FLAG_PACKET_BASED_CREDIT_MODE = 1 << 9, MLX5_QP_FLAG_UAR_PAGE_INDEX = 1 << 10, MLX5_QP_FLAG_DCI_STREAM = 1 << 11, }; enum { MLX5_SRQ_FLAG_SIGNATURE = 1 << 0, }; enum { MLX5_WQ_FLAG_SIGNATURE = 1 << 0, }; /* Increment this value if any changes that break userspace ABI * compatibility are made. */ #define MLX5_IB_UVERBS_ABI_VERSION 1 /* Make sure that all structs defined in this file remain laid out so * that they pack the same way on 32-bit and 64-bit architectures (to * avoid incompatibility between 32-bit userspace and 64-bit kernels). * In particular do not use pointer types -- pass pointers in __u64 * instead. */ struct mlx5_ib_alloc_ucontext_req { __u32 total_num_bfregs; __u32 num_low_latency_bfregs; }; enum mlx5_lib_caps { MLX5_LIB_CAP_4K_UAR = (__u64)1 << 0, MLX5_LIB_CAP_DYN_UAR = (__u64)1 << 1, }; enum mlx5_ib_alloc_uctx_v2_flags { MLX5_IB_ALLOC_UCTX_DEVX = 1 << 0, }; struct mlx5_ib_alloc_ucontext_req_v2 { __u32 total_num_bfregs; __u32 num_low_latency_bfregs; __u32 flags; __u32 comp_mask; __u8 max_cqe_version; __u8 reserved0; __u16 reserved1; __u32 reserved2; __aligned_u64 lib_caps; }; enum mlx5_ib_alloc_ucontext_resp_mask { MLX5_IB_ALLOC_UCONTEXT_RESP_MASK_CORE_CLOCK_OFFSET = 1UL << 0, MLX5_IB_ALLOC_UCONTEXT_RESP_MASK_DUMP_FILL_MKEY = 1UL << 1, MLX5_IB_ALLOC_UCONTEXT_RESP_MASK_ECE = 1UL << 2, MLX5_IB_ALLOC_UCONTEXT_RESP_MASK_SQD2RTS = 1UL << 3, MLX5_IB_ALLOC_UCONTEXT_RESP_MASK_REAL_TIME_TS = 1UL << 4, MLX5_IB_ALLOC_UCONTEXT_RESP_MASK_MKEY_UPDATE_TAG = 1UL << 5, }; enum mlx5_user_cmds_supp_uhw { MLX5_USER_CMDS_SUPP_UHW_QUERY_DEVICE = 1 << 0, MLX5_USER_CMDS_SUPP_UHW_CREATE_AH = 1 << 1, }; /* The eth_min_inline response value is set to off-by-one vs the FW * returned value to allow user-space to deal with older kernels. */ enum mlx5_user_inline_mode { MLX5_USER_INLINE_MODE_NA, MLX5_USER_INLINE_MODE_NONE, MLX5_USER_INLINE_MODE_L2, MLX5_USER_INLINE_MODE_IP, MLX5_USER_INLINE_MODE_TCP_UDP, }; enum { MLX5_USER_ALLOC_UCONTEXT_FLOW_ACTION_FLAGS_ESP_AES_GCM = 1 << 0, MLX5_USER_ALLOC_UCONTEXT_FLOW_ACTION_FLAGS_ESP_AES_GCM_REQ_METADATA = 1 << 1, MLX5_USER_ALLOC_UCONTEXT_FLOW_ACTION_FLAGS_ESP_AES_GCM_SPI_STEERING = 1 << 2, MLX5_USER_ALLOC_UCONTEXT_FLOW_ACTION_FLAGS_ESP_AES_GCM_FULL_OFFLOAD = 1 << 3, MLX5_USER_ALLOC_UCONTEXT_FLOW_ACTION_FLAGS_ESP_AES_GCM_TX_IV_IS_ESN = 1 << 4, }; struct mlx5_ib_alloc_ucontext_resp { __u32 qp_tab_size; __u32 bf_reg_size; __u32 tot_bfregs; __u32 cache_line_size; __u16 max_sq_desc_sz; __u16 max_rq_desc_sz; __u32 max_send_wqebb; __u32 max_recv_wr; __u32 max_srq_recv_wr; __u16 num_ports; __u16 flow_action_flags; __u32 comp_mask; __u32 response_length; __u8 cqe_version; __u8 cmds_supp_uhw; __u8 eth_min_inline; __u8 clock_info_versions; __aligned_u64 hca_core_clock_offset; __u32 log_uar_size; __u32 num_uars_per_page; __u32 num_dyn_bfregs; __u32 dump_fill_mkey; }; struct mlx5_ib_alloc_pd_resp { __u32 pdn; }; struct mlx5_ib_tso_caps { __u32 max_tso; /* Maximum tso payload size in bytes */ /* Corresponding bit will be set if qp type from * 'enum ib_qp_type' is supported, e.g. * supported_qpts |= 1 << IB_QPT_UD */ __u32 supported_qpts; }; struct mlx5_ib_rss_caps { __aligned_u64 rx_hash_fields_mask; /* enum mlx5_rx_hash_fields */ __u8 rx_hash_function; /* enum mlx5_rx_hash_function_flags */ __u8 reserved[7]; }; enum mlx5_ib_cqe_comp_res_format { MLX5_IB_CQE_RES_FORMAT_HASH = 1 << 0, MLX5_IB_CQE_RES_FORMAT_CSUM = 1 << 1, MLX5_IB_CQE_RES_FORMAT_CSUM_STRIDX = 1 << 2, }; struct mlx5_ib_cqe_comp_caps { __u32 max_num; __u32 supported_format; /* enum mlx5_ib_cqe_comp_res_format */ }; enum mlx5_ib_packet_pacing_cap_flags { MLX5_IB_PP_SUPPORT_BURST = 1 << 0, }; struct mlx5_packet_pacing_caps { __u32 qp_rate_limit_min; __u32 qp_rate_limit_max; /* In kpbs */ /* Corresponding bit will be set if qp type from * 'enum ib_qp_type' is supported, e.g. * supported_qpts |= 1 << IB_QPT_RAW_PACKET */ __u32 supported_qpts; __u8 cap_flags; /* enum mlx5_ib_packet_pacing_cap_flags */ __u8 reserved[3]; }; enum mlx5_ib_mpw_caps { MPW_RESERVED = 1 << 0, MLX5_IB_ALLOW_MPW = 1 << 1, MLX5_IB_SUPPORT_EMPW = 1 << 2, }; enum mlx5_ib_sw_parsing_offloads { MLX5_IB_SW_PARSING = 1 << 0, MLX5_IB_SW_PARSING_CSUM = 1 << 1, MLX5_IB_SW_PARSING_LSO = 1 << 2, }; struct mlx5_ib_sw_parsing_caps { __u32 sw_parsing_offloads; /* enum mlx5_ib_sw_parsing_offloads */ /* Corresponding bit will be set if qp type from * 'enum ib_qp_type' is supported, e.g. * supported_qpts |= 1 << IB_QPT_RAW_PACKET */ __u32 supported_qpts; }; struct mlx5_ib_striding_rq_caps { __u32 min_single_stride_log_num_of_bytes; __u32 max_single_stride_log_num_of_bytes; __u32 min_single_wqe_log_num_of_strides; __u32 max_single_wqe_log_num_of_strides; /* Corresponding bit will be set if qp type from * 'enum ib_qp_type' is supported, e.g. * supported_qpts |= 1 << IB_QPT_RAW_PACKET */ __u32 supported_qpts; __u32 reserved; }; struct mlx5_ib_dci_streams_caps { __u8 max_log_num_concurent; __u8 max_log_num_errored; }; enum mlx5_ib_query_dev_resp_flags { /* Support 128B CQE compression */ MLX5_IB_QUERY_DEV_RESP_FLAGS_CQE_128B_COMP = 1 << 0, MLX5_IB_QUERY_DEV_RESP_FLAGS_CQE_128B_PAD = 1 << 1, MLX5_IB_QUERY_DEV_RESP_PACKET_BASED_CREDIT_MODE = 1 << 2, MLX5_IB_QUERY_DEV_RESP_FLAGS_SCAT2CQE_DCT = 1 << 3, }; enum mlx5_ib_tunnel_offloads { MLX5_IB_TUNNELED_OFFLOADS_VXLAN = 1 << 0, MLX5_IB_TUNNELED_OFFLOADS_GRE = 1 << 1, MLX5_IB_TUNNELED_OFFLOADS_GENEVE = 1 << 2, MLX5_IB_TUNNELED_OFFLOADS_MPLS_GRE = 1 << 3, MLX5_IB_TUNNELED_OFFLOADS_MPLS_UDP = 1 << 4, }; struct mlx5_ib_query_device_resp { __u32 comp_mask; __u32 response_length; struct mlx5_ib_tso_caps tso_caps; struct mlx5_ib_rss_caps rss_caps; struct mlx5_ib_cqe_comp_caps cqe_comp_caps; struct mlx5_packet_pacing_caps packet_pacing_caps; __u32 mlx5_ib_support_multi_pkt_send_wqes; __u32 flags; /* Use enum mlx5_ib_query_dev_resp_flags */ struct mlx5_ib_sw_parsing_caps sw_parsing_caps; struct mlx5_ib_striding_rq_caps striding_rq_caps; __u32 tunnel_offloads_caps; /* enum mlx5_ib_tunnel_offloads */ struct mlx5_ib_dci_streams_caps dci_streams_caps; __u16 reserved; }; enum mlx5_ib_create_cq_flags { MLX5_IB_CREATE_CQ_FLAGS_CQE_128B_PAD = 1 << 0, MLX5_IB_CREATE_CQ_FLAGS_UAR_PAGE_INDEX = 1 << 1, MLX5_IB_CREATE_CQ_FLAGS_REAL_TIME_TS = 1 << 2, }; struct mlx5_ib_create_cq { __aligned_u64 buf_addr; __aligned_u64 db_addr; __u32 cqe_size; __u8 cqe_comp_en; __u8 cqe_comp_res_format; __u16 flags; __u16 uar_page_index; __u16 reserved0; __u32 reserved1; }; struct mlx5_ib_create_cq_resp { __u32 cqn; __u32 reserved; }; struct mlx5_ib_resize_cq { __aligned_u64 buf_addr; __u16 cqe_size; __u16 reserved0; __u32 reserved1; }; struct mlx5_ib_create_srq { __aligned_u64 buf_addr; __aligned_u64 db_addr; __u32 flags; __u32 reserved0; /* explicit padding (optional on i386) */ __u32 uidx; __u32 reserved1; }; struct mlx5_ib_create_srq_resp { __u32 srqn; __u32 reserved; }; struct mlx5_ib_create_qp_dci_streams { __u8 log_num_concurent; __u8 log_num_errored; }; struct mlx5_ib_create_qp { __aligned_u64 buf_addr; __aligned_u64 db_addr; __u32 sq_wqe_count; __u32 rq_wqe_count; __u32 rq_wqe_shift; __u32 flags; __u32 uidx; __u32 bfreg_index; union { __aligned_u64 sq_buf_addr; __aligned_u64 access_key; }; __u32 ece_options; struct mlx5_ib_create_qp_dci_streams dci_streams; __u16 reserved; }; /* RX Hash function flags */ enum mlx5_rx_hash_function_flags { MLX5_RX_HASH_FUNC_TOEPLITZ = 1 << 0, }; /* * RX Hash flags, these flags allows to set which incoming packet's field should * participates in RX Hash. Each flag represent certain packet's field, * when the flag is set the field that is represented by the flag will * participate in RX Hash calculation. * Note: *IPV4 and *IPV6 flags can't be enabled together on the same QP * and *TCP and *UDP flags can't be enabled together on the same QP. */ enum mlx5_rx_hash_fields { MLX5_RX_HASH_SRC_IPV4 = 1 << 0, MLX5_RX_HASH_DST_IPV4 = 1 << 1, MLX5_RX_HASH_SRC_IPV6 = 1 << 2, MLX5_RX_HASH_DST_IPV6 = 1 << 3, MLX5_RX_HASH_SRC_PORT_TCP = 1 << 4, MLX5_RX_HASH_DST_PORT_TCP = 1 << 5, MLX5_RX_HASH_SRC_PORT_UDP = 1 << 6, MLX5_RX_HASH_DST_PORT_UDP = 1 << 7, MLX5_RX_HASH_IPSEC_SPI = 1 << 8, /* Save bits for future fields */ MLX5_RX_HASH_INNER = (1UL << 31), }; struct mlx5_ib_create_qp_rss { __aligned_u64 rx_hash_fields_mask; /* enum mlx5_rx_hash_fields */ __u8 rx_hash_function; /* enum mlx5_rx_hash_function_flags */ __u8 rx_key_len; /* valid only for Toeplitz */ __u8 reserved[6]; __u8 rx_hash_key[128]; /* valid only for Toeplitz */ __u32 comp_mask; __u32 flags; }; enum mlx5_ib_create_qp_resp_mask { MLX5_IB_CREATE_QP_RESP_MASK_TIRN = 1UL << 0, MLX5_IB_CREATE_QP_RESP_MASK_TISN = 1UL << 1, MLX5_IB_CREATE_QP_RESP_MASK_RQN = 1UL << 2, MLX5_IB_CREATE_QP_RESP_MASK_SQN = 1UL << 3, MLX5_IB_CREATE_QP_RESP_MASK_TIR_ICM_ADDR = 1UL << 4, }; struct mlx5_ib_create_qp_resp { __u32 bfreg_index; __u32 ece_options; __u32 comp_mask; __u32 tirn; __u32 tisn; __u32 rqn; __u32 sqn; __u32 reserved1; __u64 tir_icm_addr; }; struct mlx5_ib_alloc_mw { __u32 comp_mask; __u8 num_klms; __u8 reserved1; __u16 reserved2; }; enum mlx5_ib_create_wq_mask { MLX5_IB_CREATE_WQ_STRIDING_RQ = (1 << 0), }; struct mlx5_ib_create_wq { __aligned_u64 buf_addr; __aligned_u64 db_addr; __u32 rq_wqe_count; __u32 rq_wqe_shift; __u32 user_index; __u32 flags; __u32 comp_mask; __u32 single_stride_log_num_of_bytes; __u32 single_wqe_log_num_of_strides; __u32 two_byte_shift_en; }; struct mlx5_ib_create_ah_resp { __u32 response_length; __u8 dmac[ETH_ALEN]; __u8 reserved[6]; }; struct mlx5_ib_burst_info { __u32 max_burst_sz; __u16 typical_pkt_sz; __u16 reserved; }; struct mlx5_ib_modify_qp { __u32 comp_mask; struct mlx5_ib_burst_info burst_info; __u32 ece_options; }; struct mlx5_ib_modify_qp_resp { __u32 response_length; __u32 dctn; __u32 ece_options; __u32 reserved; }; struct mlx5_ib_create_wq_resp { __u32 response_length; __u32 reserved; }; struct mlx5_ib_create_rwq_ind_tbl_resp { __u32 response_length; __u32 reserved; }; struct mlx5_ib_modify_wq { __u32 comp_mask; __u32 reserved; }; struct mlx5_ib_clock_info { __u32 sign; __u32 resv; __aligned_u64 nsec; __aligned_u64 cycles; __aligned_u64 frac; __u32 mult; __u32 shift; __aligned_u64 mask; __aligned_u64 overflow_period; }; enum mlx5_ib_mmap_cmd { MLX5_IB_MMAP_REGULAR_PAGE = 0, MLX5_IB_MMAP_GET_CONTIGUOUS_PAGES = 1, MLX5_IB_MMAP_WC_PAGE = 2, MLX5_IB_MMAP_NC_PAGE = 3, /* 5 is chosen in order to be compatible with old versions of libmlx5 */ MLX5_IB_MMAP_CORE_CLOCK = 5, MLX5_IB_MMAP_ALLOC_WC = 6, MLX5_IB_MMAP_CLOCK_INFO = 7, MLX5_IB_MMAP_DEVICE_MEM = 8, }; enum { MLX5_IB_CLOCK_INFO_KERNEL_UPDATING = 1, }; /* Bit indexes for the mlx5_alloc_ucontext_resp.clock_info_versions bitmap */ enum { MLX5_IB_CLOCK_INFO_V1 = 0, }; struct mlx5_ib_flow_counters_desc { __u32 description; __u32 index; }; struct mlx5_ib_flow_counters_data { RDMA_UAPI_PTR(struct mlx5_ib_flow_counters_desc *, counters_data); __u32 ncounters; __u32 reserved; }; struct mlx5_ib_create_flow { __u32 ncounters_data; __u32 reserved; /* * Following are counters data based on ncounters_data, each * entry in the data[] should match a corresponding counter object * that was pointed by a counters spec upon the flow creation */ struct mlx5_ib_flow_counters_data data[]; }; #endif /* MLX5_ABI_USER_H */ mlx5_user_ioctl_cmds.h000064400000024771151703010350011046 0ustar00/* * Copyright (c) 2018, Mellanox Technologies inc. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef MLX5_USER_IOCTL_CMDS_H #define MLX5_USER_IOCTL_CMDS_H #include <linux/types.h> #include <rdma/ib_user_ioctl_cmds.h> enum mlx5_ib_create_flow_action_attrs { /* This attribute belong to the driver namespace */ MLX5_IB_ATTR_CREATE_FLOW_ACTION_FLAGS = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_dm_methods { MLX5_IB_METHOD_DM_MAP_OP_ADDR = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_DM_QUERY, }; enum mlx5_ib_dm_map_op_addr_attrs { MLX5_IB_ATTR_DM_MAP_OP_ADDR_REQ_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DM_MAP_OP_ADDR_REQ_OP, MLX5_IB_ATTR_DM_MAP_OP_ADDR_RESP_START_OFFSET, MLX5_IB_ATTR_DM_MAP_OP_ADDR_RESP_PAGE_INDEX, }; enum mlx5_ib_query_dm_attrs { MLX5_IB_ATTR_QUERY_DM_REQ_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_QUERY_DM_RESP_START_OFFSET, MLX5_IB_ATTR_QUERY_DM_RESP_PAGE_INDEX, MLX5_IB_ATTR_QUERY_DM_RESP_LENGTH, }; enum mlx5_ib_alloc_dm_attrs { MLX5_IB_ATTR_ALLOC_DM_RESP_START_OFFSET = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_ALLOC_DM_RESP_PAGE_INDEX, MLX5_IB_ATTR_ALLOC_DM_REQ_TYPE, }; enum mlx5_ib_devx_methods { MLX5_IB_METHOD_DEVX_OTHER = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_DEVX_QUERY_UAR, MLX5_IB_METHOD_DEVX_QUERY_EQN, MLX5_IB_METHOD_DEVX_SUBSCRIBE_EVENT, }; enum mlx5_ib_devx_other_attrs { MLX5_IB_ATTR_DEVX_OTHER_CMD_IN = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_OTHER_CMD_OUT, }; enum mlx5_ib_devx_obj_create_attrs { MLX5_IB_ATTR_DEVX_OBJ_CREATE_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_OBJ_CREATE_CMD_IN, MLX5_IB_ATTR_DEVX_OBJ_CREATE_CMD_OUT, }; enum mlx5_ib_devx_query_uar_attrs { MLX5_IB_ATTR_DEVX_QUERY_UAR_USER_IDX = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_QUERY_UAR_DEV_IDX, }; enum mlx5_ib_devx_obj_destroy_attrs { MLX5_IB_ATTR_DEVX_OBJ_DESTROY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_devx_obj_modify_attrs { MLX5_IB_ATTR_DEVX_OBJ_MODIFY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_OBJ_MODIFY_CMD_IN, MLX5_IB_ATTR_DEVX_OBJ_MODIFY_CMD_OUT, }; enum mlx5_ib_devx_obj_query_attrs { MLX5_IB_ATTR_DEVX_OBJ_QUERY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_OBJ_QUERY_CMD_IN, MLX5_IB_ATTR_DEVX_OBJ_QUERY_CMD_OUT, }; enum mlx5_ib_devx_obj_query_async_attrs { MLX5_IB_ATTR_DEVX_OBJ_QUERY_ASYNC_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_OBJ_QUERY_ASYNC_CMD_IN, MLX5_IB_ATTR_DEVX_OBJ_QUERY_ASYNC_FD, MLX5_IB_ATTR_DEVX_OBJ_QUERY_ASYNC_WR_ID, MLX5_IB_ATTR_DEVX_OBJ_QUERY_ASYNC_OUT_LEN, }; enum mlx5_ib_devx_subscribe_event_attrs { MLX5_IB_ATTR_DEVX_SUBSCRIBE_EVENT_FD_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_SUBSCRIBE_EVENT_OBJ_HANDLE, MLX5_IB_ATTR_DEVX_SUBSCRIBE_EVENT_TYPE_NUM_LIST, MLX5_IB_ATTR_DEVX_SUBSCRIBE_EVENT_FD_NUM, MLX5_IB_ATTR_DEVX_SUBSCRIBE_EVENT_COOKIE, }; enum mlx5_ib_devx_query_eqn_attrs { MLX5_IB_ATTR_DEVX_QUERY_EQN_USER_VEC = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_QUERY_EQN_DEV_EQN, }; enum mlx5_ib_devx_obj_methods { MLX5_IB_METHOD_DEVX_OBJ_CREATE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_DEVX_OBJ_DESTROY, MLX5_IB_METHOD_DEVX_OBJ_MODIFY, MLX5_IB_METHOD_DEVX_OBJ_QUERY, MLX5_IB_METHOD_DEVX_OBJ_ASYNC_QUERY, }; enum mlx5_ib_var_alloc_attrs { MLX5_IB_ATTR_VAR_OBJ_ALLOC_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_VAR_OBJ_ALLOC_MMAP_OFFSET, MLX5_IB_ATTR_VAR_OBJ_ALLOC_MMAP_LENGTH, MLX5_IB_ATTR_VAR_OBJ_ALLOC_PAGE_ID, }; enum mlx5_ib_var_obj_destroy_attrs { MLX5_IB_ATTR_VAR_OBJ_DESTROY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_var_obj_methods { MLX5_IB_METHOD_VAR_OBJ_ALLOC = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_VAR_OBJ_DESTROY, }; enum mlx5_ib_uar_alloc_attrs { MLX5_IB_ATTR_UAR_OBJ_ALLOC_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_UAR_OBJ_ALLOC_TYPE, MLX5_IB_ATTR_UAR_OBJ_ALLOC_MMAP_OFFSET, MLX5_IB_ATTR_UAR_OBJ_ALLOC_MMAP_LENGTH, MLX5_IB_ATTR_UAR_OBJ_ALLOC_PAGE_ID, }; enum mlx5_ib_uar_obj_destroy_attrs { MLX5_IB_ATTR_UAR_OBJ_DESTROY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_uar_obj_methods { MLX5_IB_METHOD_UAR_OBJ_ALLOC = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_UAR_OBJ_DESTROY, }; enum mlx5_ib_devx_umem_reg_attrs { MLX5_IB_ATTR_DEVX_UMEM_REG_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_UMEM_REG_ADDR, MLX5_IB_ATTR_DEVX_UMEM_REG_LEN, MLX5_IB_ATTR_DEVX_UMEM_REG_ACCESS, MLX5_IB_ATTR_DEVX_UMEM_REG_OUT_ID, MLX5_IB_ATTR_DEVX_UMEM_REG_PGSZ_BITMAP, }; enum mlx5_ib_devx_umem_dereg_attrs { MLX5_IB_ATTR_DEVX_UMEM_DEREG_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_pp_obj_methods { MLX5_IB_METHOD_PP_OBJ_ALLOC = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_PP_OBJ_DESTROY, }; enum mlx5_ib_pp_alloc_attrs { MLX5_IB_ATTR_PP_OBJ_ALLOC_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_PP_OBJ_ALLOC_CTX, MLX5_IB_ATTR_PP_OBJ_ALLOC_FLAGS, MLX5_IB_ATTR_PP_OBJ_ALLOC_INDEX, }; enum mlx5_ib_pp_obj_destroy_attrs { MLX5_IB_ATTR_PP_OBJ_DESTROY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_devx_umem_methods { MLX5_IB_METHOD_DEVX_UMEM_REG = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_DEVX_UMEM_DEREG, }; enum mlx5_ib_devx_async_cmd_fd_alloc_attrs { MLX5_IB_ATTR_DEVX_ASYNC_CMD_FD_ALLOC_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_devx_async_event_fd_alloc_attrs { MLX5_IB_ATTR_DEVX_ASYNC_EVENT_FD_ALLOC_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_ASYNC_EVENT_FD_ALLOC_FLAGS, }; enum mlx5_ib_devx_async_cmd_fd_methods { MLX5_IB_METHOD_DEVX_ASYNC_CMD_FD_ALLOC = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_devx_async_event_fd_methods { MLX5_IB_METHOD_DEVX_ASYNC_EVENT_FD_ALLOC = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_objects { MLX5_IB_OBJECT_DEVX = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_OBJECT_DEVX_OBJ, MLX5_IB_OBJECT_DEVX_UMEM, MLX5_IB_OBJECT_FLOW_MATCHER, MLX5_IB_OBJECT_DEVX_ASYNC_CMD_FD, MLX5_IB_OBJECT_DEVX_ASYNC_EVENT_FD, MLX5_IB_OBJECT_VAR, MLX5_IB_OBJECT_PP, MLX5_IB_OBJECT_UAR, MLX5_IB_OBJECT_STEERING_ANCHOR, }; enum mlx5_ib_flow_matcher_create_attrs { MLX5_IB_ATTR_FLOW_MATCHER_CREATE_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_FLOW_MATCHER_MATCH_MASK, MLX5_IB_ATTR_FLOW_MATCHER_FLOW_TYPE, MLX5_IB_ATTR_FLOW_MATCHER_MATCH_CRITERIA, MLX5_IB_ATTR_FLOW_MATCHER_FLOW_FLAGS, MLX5_IB_ATTR_FLOW_MATCHER_FT_TYPE, }; enum mlx5_ib_flow_matcher_destroy_attrs { MLX5_IB_ATTR_FLOW_MATCHER_DESTROY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_flow_matcher_methods { MLX5_IB_METHOD_FLOW_MATCHER_CREATE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_FLOW_MATCHER_DESTROY, }; enum mlx5_ib_flow_steering_anchor_create_attrs { MLX5_IB_ATTR_STEERING_ANCHOR_CREATE_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_STEERING_ANCHOR_FT_TYPE, MLX5_IB_ATTR_STEERING_ANCHOR_PRIORITY, MLX5_IB_ATTR_STEERING_ANCHOR_FT_ID, }; enum mlx5_ib_flow_steering_anchor_destroy_attrs { MLX5_IB_ATTR_STEERING_ANCHOR_DESTROY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_steering_anchor_methods { MLX5_IB_METHOD_STEERING_ANCHOR_CREATE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_STEERING_ANCHOR_DESTROY, }; enum mlx5_ib_device_query_context_attrs { MLX5_IB_ATTR_QUERY_CONTEXT_RESP_UCTX = (1U << UVERBS_ID_NS_SHIFT), }; #define MLX5_IB_DW_MATCH_PARAM 0xA0 struct mlx5_ib_match_params { __u32 match_params[MLX5_IB_DW_MATCH_PARAM]; }; enum mlx5_ib_flow_type { MLX5_IB_FLOW_TYPE_NORMAL, MLX5_IB_FLOW_TYPE_SNIFFER, MLX5_IB_FLOW_TYPE_ALL_DEFAULT, MLX5_IB_FLOW_TYPE_MC_DEFAULT, }; enum mlx5_ib_create_flow_flags { MLX5_IB_ATTR_CREATE_FLOW_FLAGS_DEFAULT_MISS = 1 << 0, MLX5_IB_ATTR_CREATE_FLOW_FLAGS_DROP = 1 << 1, }; enum mlx5_ib_create_flow_attrs { MLX5_IB_ATTR_CREATE_FLOW_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_CREATE_FLOW_MATCH_VALUE, MLX5_IB_ATTR_CREATE_FLOW_DEST_QP, MLX5_IB_ATTR_CREATE_FLOW_DEST_DEVX, MLX5_IB_ATTR_CREATE_FLOW_MATCHER, MLX5_IB_ATTR_CREATE_FLOW_ARR_FLOW_ACTIONS, MLX5_IB_ATTR_CREATE_FLOW_TAG, MLX5_IB_ATTR_CREATE_FLOW_ARR_COUNTERS_DEVX, MLX5_IB_ATTR_CREATE_FLOW_ARR_COUNTERS_DEVX_OFFSET, MLX5_IB_ATTR_CREATE_FLOW_FLAGS, }; enum mlx5_ib_destoy_flow_attrs { MLX5_IB_ATTR_DESTROY_FLOW_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_flow_methods { MLX5_IB_METHOD_CREATE_FLOW = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_DESTROY_FLOW, }; enum mlx5_ib_flow_action_methods { MLX5_IB_METHOD_FLOW_ACTION_CREATE_MODIFY_HEADER = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_FLOW_ACTION_CREATE_PACKET_REFORMAT, }; enum mlx5_ib_create_flow_action_create_modify_header_attrs { MLX5_IB_ATTR_CREATE_MODIFY_HEADER_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_CREATE_MODIFY_HEADER_ACTIONS_PRM, MLX5_IB_ATTR_CREATE_MODIFY_HEADER_FT_TYPE, }; enum mlx5_ib_create_flow_action_create_packet_reformat_attrs { MLX5_IB_ATTR_CREATE_PACKET_REFORMAT_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_CREATE_PACKET_REFORMAT_TYPE, MLX5_IB_ATTR_CREATE_PACKET_REFORMAT_FT_TYPE, MLX5_IB_ATTR_CREATE_PACKET_REFORMAT_DATA_BUF, }; enum mlx5_ib_query_pd_attrs { MLX5_IB_ATTR_QUERY_PD_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_QUERY_PD_RESP_PDN, }; enum mlx5_ib_pd_methods { MLX5_IB_METHOD_PD_QUERY = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_device_methods { MLX5_IB_METHOD_QUERY_PORT = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_query_port_attrs { MLX5_IB_ATTR_QUERY_PORT_PORT_NUM = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_QUERY_PORT, }; #endif mlx5_user_ioctl_verbs.h000064400000006777151703010350011247 0ustar00/* * Copyright (c) 2018, Mellanox Technologies inc. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef MLX5_USER_IOCTL_VERBS_H #define MLX5_USER_IOCTL_VERBS_H #include <linux/types.h> enum mlx5_ib_uapi_flow_action_flags { MLX5_IB_UAPI_FLOW_ACTION_FLAGS_REQUIRE_METADATA = 1 << 0, }; enum mlx5_ib_uapi_flow_table_type { MLX5_IB_UAPI_FLOW_TABLE_TYPE_NIC_RX = 0x0, MLX5_IB_UAPI_FLOW_TABLE_TYPE_NIC_TX = 0x1, MLX5_IB_UAPI_FLOW_TABLE_TYPE_FDB = 0x2, MLX5_IB_UAPI_FLOW_TABLE_TYPE_RDMA_RX = 0x3, MLX5_IB_UAPI_FLOW_TABLE_TYPE_RDMA_TX = 0x4, }; enum mlx5_ib_uapi_flow_action_packet_reformat_type { MLX5_IB_UAPI_FLOW_ACTION_PACKET_REFORMAT_TYPE_L2_TUNNEL_TO_L2 = 0x0, MLX5_IB_UAPI_FLOW_ACTION_PACKET_REFORMAT_TYPE_L2_TO_L2_TUNNEL = 0x1, MLX5_IB_UAPI_FLOW_ACTION_PACKET_REFORMAT_TYPE_L3_TUNNEL_TO_L2 = 0x2, MLX5_IB_UAPI_FLOW_ACTION_PACKET_REFORMAT_TYPE_L2_TO_L3_TUNNEL = 0x3, }; struct mlx5_ib_uapi_devx_async_cmd_hdr { __aligned_u64 wr_id; __u8 out_data[]; }; enum mlx5_ib_uapi_dm_type { MLX5_IB_UAPI_DM_TYPE_MEMIC, MLX5_IB_UAPI_DM_TYPE_STEERING_SW_ICM, MLX5_IB_UAPI_DM_TYPE_HEADER_MODIFY_SW_ICM, MLX5_IB_UAPI_DM_TYPE_HEADER_MODIFY_PATTERN_SW_ICM, }; enum mlx5_ib_uapi_devx_create_event_channel_flags { MLX5_IB_UAPI_DEVX_CR_EV_CH_FLAGS_OMIT_DATA = 1 << 0, }; struct mlx5_ib_uapi_devx_async_event_hdr { __aligned_u64 cookie; __u8 out_data[]; }; enum mlx5_ib_uapi_pp_alloc_flags { MLX5_IB_UAPI_PP_ALLOC_FLAGS_DEDICATED_INDEX = 1 << 0, }; enum mlx5_ib_uapi_uar_alloc_type { MLX5_IB_UAPI_UAR_ALLOC_TYPE_BF = 0x0, MLX5_IB_UAPI_UAR_ALLOC_TYPE_NC = 0x1, }; enum mlx5_ib_uapi_query_port_flags { MLX5_IB_UAPI_QUERY_PORT_VPORT = 1 << 0, MLX5_IB_UAPI_QUERY_PORT_VPORT_VHCA_ID = 1 << 1, MLX5_IB_UAPI_QUERY_PORT_VPORT_STEERING_ICM_RX = 1 << 2, MLX5_IB_UAPI_QUERY_PORT_VPORT_STEERING_ICM_TX = 1 << 3, MLX5_IB_UAPI_QUERY_PORT_VPORT_REG_C0 = 1 << 4, MLX5_IB_UAPI_QUERY_PORT_ESW_OWNER_VHCA_ID = 1 << 5, }; struct mlx5_ib_uapi_reg { __u32 value; __u32 mask; }; struct mlx5_ib_uapi_query_port { __aligned_u64 flags; __u16 vport; __u16 vport_vhca_id; __u16 esw_owner_vhca_id; __u16 rsvd0; __aligned_u64 vport_steering_icm_rx; __aligned_u64 vport_steering_icm_tx; struct mlx5_ib_uapi_reg reg_c0; }; #endif mthca-abi.h000064400000005757151703010350006553 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2005 Topspin Communications. All rights reserved. * Copyright (c) 2005, 2006 Cisco Systems. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef MTHCA_ABI_USER_H #define MTHCA_ABI_USER_H #include <linux/types.h> /* * Increment this value if any changes that break userspace ABI * compatibility are made. */ #define MTHCA_UVERBS_ABI_VERSION 1 /* * Make sure that all structs defined in this file remain laid out so * that they pack the same way on 32-bit and 64-bit architectures (to * avoid incompatibility between 32-bit userspace and 64-bit kernels). * In particular do not use pointer types -- pass pointers in __u64 * instead. */ struct mthca_alloc_ucontext_resp { __u32 qp_tab_size; __u32 uarc_size; }; struct mthca_alloc_pd_resp { __u32 pdn; __u32 reserved; }; /* * Mark the memory region with a DMA attribute that causes * in-flight DMA to be flushed when the region is written to: */ #define MTHCA_MR_DMASYNC 0x1 struct mthca_reg_mr { __u32 mr_attrs; __u32 reserved; }; struct mthca_create_cq { __u32 lkey; __u32 pdn; __aligned_u64 arm_db_page; __aligned_u64 set_db_page; __u32 arm_db_index; __u32 set_db_index; }; struct mthca_create_cq_resp { __u32 cqn; __u32 reserved; }; struct mthca_resize_cq { __u32 lkey; __u32 reserved; }; struct mthca_create_srq { __u32 lkey; __u32 db_index; __aligned_u64 db_page; }; struct mthca_create_srq_resp { __u32 srqn; __u32 reserved; }; struct mthca_create_qp { __u32 lkey; __u32 reserved; __aligned_u64 sq_db_page; __aligned_u64 rq_db_page; __u32 sq_db_index; __u32 rq_db_index; }; #endif /* MTHCA_ABI_USER_H */ ocrdma-abi.h000064400000010024151703010350006703 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR BSD-2-Clause) */ /* This file is part of the Emulex RoCE Device Driver for * RoCE (RDMA over Converged Ethernet) adapters. * Copyright (C) 2012-2015 Emulex. All rights reserved. * EMULEX and SLI are trademarks of Emulex. * www.emulex.com * * This software is available to you under a choice of one of two licenses. * You may choose to be licensed under the terms of the GNU General Public * License (GPL) Version 2, available from the file COPYING in the main * directory of this source tree, or the BSD license below: * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * - Redistributions of source code must retain the above copyright notice, * this list of conditions and the following disclaimer. * * - Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the distribution. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" * AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO,THE * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE * ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT HOLDER OR CONTRIBUTORS BE * LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR * CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF * SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR * BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, * WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR * OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF * ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. * * Contact Information: * linux-drivers@emulex.com * * Emulex * 3333 Susan Street * Costa Mesa, CA 92626 */ #ifndef OCRDMA_ABI_USER_H #define OCRDMA_ABI_USER_H #include <linux/types.h> #define OCRDMA_ABI_VERSION 2 #define OCRDMA_BE_ROCE_ABI_VERSION 1 /* user kernel communication data structures. */ struct ocrdma_alloc_ucontext_resp { __u32 dev_id; __u32 wqe_size; __u32 max_inline_data; __u32 dpp_wqe_size; __aligned_u64 ah_tbl_page; __u32 ah_tbl_len; __u32 rqe_size; __u8 fw_ver[32]; /* for future use/new features in progress */ __aligned_u64 rsvd1; __aligned_u64 rsvd2; }; struct ocrdma_alloc_pd_ureq { __u32 rsvd[2]; }; struct ocrdma_alloc_pd_uresp { __u32 id; __u32 dpp_enabled; __u32 dpp_page_addr_hi; __u32 dpp_page_addr_lo; __u32 rsvd[2]; }; struct ocrdma_create_cq_ureq { __u32 dpp_cq; __u32 rsvd; /* pad */ }; #define MAX_CQ_PAGES 8 struct ocrdma_create_cq_uresp { __u32 cq_id; __u32 page_size; __u32 num_pages; __u32 max_hw_cqe; __aligned_u64 page_addr[MAX_CQ_PAGES]; __aligned_u64 db_page_addr; __u32 db_page_size; __u32 phase_change; /* for future use/new features in progress */ __aligned_u64 rsvd1; __aligned_u64 rsvd2; }; #define MAX_QP_PAGES 8 #define MAX_UD_AV_PAGES 8 struct ocrdma_create_qp_ureq { __u8 enable_dpp_cq; __u8 rsvd; __u16 dpp_cq_id; __u32 rsvd1; /* pad */ }; struct ocrdma_create_qp_uresp { __u16 qp_id; __u16 sq_dbid; __u16 rq_dbid; __u16 resv0; /* pad */ __u32 sq_page_size; __u32 rq_page_size; __u32 num_sq_pages; __u32 num_rq_pages; __aligned_u64 sq_page_addr[MAX_QP_PAGES]; __aligned_u64 rq_page_addr[MAX_QP_PAGES]; __aligned_u64 db_page_addr; __u32 db_page_size; __u32 dpp_credit; __u32 dpp_offset; __u32 num_wqe_allocated; __u32 num_rqe_allocated; __u32 db_sq_offset; __u32 db_rq_offset; __u32 db_shift; __aligned_u64 rsvd[11]; }; struct ocrdma_create_srq_uresp { __u16 rq_dbid; __u16 resv0; /* pad */ __u32 resv1; __u32 rq_page_size; __u32 num_rq_pages; __aligned_u64 rq_page_addr[MAX_QP_PAGES]; __aligned_u64 db_page_addr; __u32 db_page_size; __u32 num_rqe_allocated; __u32 db_rq_offset; __u32 db_shift; __aligned_u64 rsvd2; __aligned_u64 rsvd3; }; #endif /* OCRDMA_ABI_USER_H */ qedr-abi.h000064400000010323151703010350006373 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* QLogic qedr NIC Driver * Copyright (c) 2015-2016 QLogic Corporation * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and /or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef __QEDR_USER_H__ #define __QEDR_USER_H__ #include <linux/types.h> #define QEDR_ABI_VERSION (8) /* user kernel communication data structures. */ enum qedr_alloc_ucontext_flags { QEDR_ALLOC_UCTX_EDPM_MODE = 1 << 0, QEDR_ALLOC_UCTX_DB_REC = 1 << 1, QEDR_SUPPORT_DPM_SIZES = 1 << 2, }; struct qedr_alloc_ucontext_req { __u32 context_flags; __u32 reserved; }; #define QEDR_LDPM_MAX_SIZE (8192) #define QEDR_EDPM_TRANS_SIZE (64) #define QEDR_EDPM_MAX_SIZE (ROCE_REQ_MAX_INLINE_DATA_SIZE) enum qedr_rdma_dpm_type { QEDR_DPM_TYPE_NONE = 0, QEDR_DPM_TYPE_ROCE_ENHANCED = 1 << 0, QEDR_DPM_TYPE_ROCE_LEGACY = 1 << 1, QEDR_DPM_TYPE_IWARP_LEGACY = 1 << 2, QEDR_DPM_TYPE_ROCE_EDPM_MODE = 1 << 3, QEDR_DPM_SIZES_SET = 1 << 4, }; struct qedr_alloc_ucontext_resp { __aligned_u64 db_pa; __u32 db_size; __u32 max_send_wr; __u32 max_recv_wr; __u32 max_srq_wr; __u32 sges_per_send_wr; __u32 sges_per_recv_wr; __u32 sges_per_srq_wr; __u32 max_cqes; __u8 dpm_flags; __u8 wids_enabled; __u16 wid_count; __u16 ldpm_limit_size; __u8 edpm_trans_size; __u8 reserved; __u16 edpm_limit_size; __u8 padding[6]; }; struct qedr_alloc_pd_ureq { __aligned_u64 rsvd1; }; struct qedr_alloc_pd_uresp { __u32 pd_id; __u32 reserved; }; struct qedr_create_cq_ureq { __aligned_u64 addr; __aligned_u64 len; }; struct qedr_create_cq_uresp { __u32 db_offset; __u16 icid; __u16 reserved; __aligned_u64 db_rec_addr; }; struct qedr_create_qp_ureq { __u32 qp_handle_hi; __u32 qp_handle_lo; /* SQ */ /* user space virtual address of SQ buffer */ __aligned_u64 sq_addr; /* length of SQ buffer */ __aligned_u64 sq_len; /* RQ */ /* user space virtual address of RQ buffer */ __aligned_u64 rq_addr; /* length of RQ buffer */ __aligned_u64 rq_len; }; struct qedr_create_qp_uresp { __u32 qp_id; __u32 atomic_supported; /* SQ */ __u32 sq_db_offset; __u16 sq_icid; /* RQ */ __u32 rq_db_offset; __u16 rq_icid; __u32 rq_db2_offset; __u32 reserved; /* address of SQ doorbell recovery user entry */ __aligned_u64 sq_db_rec_addr; /* address of RQ doorbell recovery user entry */ __aligned_u64 rq_db_rec_addr; }; struct qedr_create_srq_ureq { /* user space virtual address of producer pair */ __aligned_u64 prod_pair_addr; /* user space virtual address of SRQ buffer */ __aligned_u64 srq_addr; /* length of SRQ buffer */ __aligned_u64 srq_len; }; struct qedr_create_srq_uresp { __u16 srq_id; __u16 reserved0; __u32 reserved1; }; /* doorbell recovery entry allocated and populated by userspace doorbelling * entities and mapped to kernel. Kernel uses this to register doorbell * information with doorbell drop recovery mechanism. */ struct qedr_user_db_rec { __aligned_u64 db_data; /* doorbell data */ }; #endif /* __QEDR_USER_H__ */ rdma_netlink.h000064400000035213151703010350007363 0ustar00/* SPDX-License-Identifier: GPL-2.0 WITH Linux-syscall-note */ #ifndef _RDMA_NETLINK_H #define _RDMA_NETLINK_H #include <linux/types.h> enum { RDMA_NL_IWCM = 2, RDMA_NL_RSVD, RDMA_NL_LS, /* RDMA Local Services */ RDMA_NL_NLDEV, /* RDMA device interface */ RDMA_NL_NUM_CLIENTS }; enum { RDMA_NL_GROUP_IWPM = 2, RDMA_NL_GROUP_LS, RDMA_NL_NUM_GROUPS }; #define RDMA_NL_GET_CLIENT(type) ((type & (((1 << 6) - 1) << 10)) >> 10) #define RDMA_NL_GET_OP(type) (type & ((1 << 10) - 1)) #define RDMA_NL_GET_TYPE(client, op) ((client << 10) + op) /* The minimum version that the iwpm kernel supports */ #define IWPM_UABI_VERSION_MIN 3 /* The latest version that the iwpm kernel supports */ #define IWPM_UABI_VERSION 4 /* iwarp port mapper message flags */ enum { /* Do not map the port for this IWPM request */ IWPM_FLAGS_NO_PORT_MAP = (1 << 0), }; /* iwarp port mapper op-codes */ enum { RDMA_NL_IWPM_REG_PID = 0, RDMA_NL_IWPM_ADD_MAPPING, RDMA_NL_IWPM_QUERY_MAPPING, RDMA_NL_IWPM_REMOVE_MAPPING, RDMA_NL_IWPM_REMOTE_INFO, RDMA_NL_IWPM_HANDLE_ERR, RDMA_NL_IWPM_MAPINFO, RDMA_NL_IWPM_MAPINFO_NUM, RDMA_NL_IWPM_HELLO, RDMA_NL_IWPM_NUM_OPS }; enum { IWPM_NLA_REG_PID_UNSPEC = 0, IWPM_NLA_REG_PID_SEQ, IWPM_NLA_REG_IF_NAME, IWPM_NLA_REG_IBDEV_NAME, IWPM_NLA_REG_ULIB_NAME, IWPM_NLA_REG_PID_MAX }; enum { IWPM_NLA_RREG_PID_UNSPEC = 0, IWPM_NLA_RREG_PID_SEQ, IWPM_NLA_RREG_IBDEV_NAME, IWPM_NLA_RREG_ULIB_NAME, IWPM_NLA_RREG_ULIB_VER, IWPM_NLA_RREG_PID_ERR, IWPM_NLA_RREG_PID_MAX }; enum { IWPM_NLA_MANAGE_MAPPING_UNSPEC = 0, IWPM_NLA_MANAGE_MAPPING_SEQ, IWPM_NLA_MANAGE_ADDR, IWPM_NLA_MANAGE_FLAGS, IWPM_NLA_MANAGE_MAPPING_MAX }; enum { IWPM_NLA_RMANAGE_MAPPING_UNSPEC = 0, IWPM_NLA_RMANAGE_MAPPING_SEQ, IWPM_NLA_RMANAGE_ADDR, IWPM_NLA_RMANAGE_MAPPED_LOC_ADDR, /* The following maintains bisectability of rdma-core */ IWPM_NLA_MANAGE_MAPPED_LOC_ADDR = IWPM_NLA_RMANAGE_MAPPED_LOC_ADDR, IWPM_NLA_RMANAGE_MAPPING_ERR, IWPM_NLA_RMANAGE_MAPPING_MAX }; #define IWPM_NLA_MAPINFO_SEND_MAX 3 #define IWPM_NLA_REMOVE_MAPPING_MAX 3 enum { IWPM_NLA_QUERY_MAPPING_UNSPEC = 0, IWPM_NLA_QUERY_MAPPING_SEQ, IWPM_NLA_QUERY_LOCAL_ADDR, IWPM_NLA_QUERY_REMOTE_ADDR, IWPM_NLA_QUERY_FLAGS, IWPM_NLA_QUERY_MAPPING_MAX, }; enum { IWPM_NLA_RQUERY_MAPPING_UNSPEC = 0, IWPM_NLA_RQUERY_MAPPING_SEQ, IWPM_NLA_RQUERY_LOCAL_ADDR, IWPM_NLA_RQUERY_REMOTE_ADDR, IWPM_NLA_RQUERY_MAPPED_LOC_ADDR, IWPM_NLA_RQUERY_MAPPED_REM_ADDR, IWPM_NLA_RQUERY_MAPPING_ERR, IWPM_NLA_RQUERY_MAPPING_MAX }; enum { IWPM_NLA_MAPINFO_REQ_UNSPEC = 0, IWPM_NLA_MAPINFO_ULIB_NAME, IWPM_NLA_MAPINFO_ULIB_VER, IWPM_NLA_MAPINFO_REQ_MAX }; enum { IWPM_NLA_MAPINFO_UNSPEC = 0, IWPM_NLA_MAPINFO_LOCAL_ADDR, IWPM_NLA_MAPINFO_MAPPED_ADDR, IWPM_NLA_MAPINFO_FLAGS, IWPM_NLA_MAPINFO_MAX }; enum { IWPM_NLA_MAPINFO_NUM_UNSPEC = 0, IWPM_NLA_MAPINFO_SEQ, IWPM_NLA_MAPINFO_SEND_NUM, IWPM_NLA_MAPINFO_ACK_NUM, IWPM_NLA_MAPINFO_NUM_MAX }; enum { IWPM_NLA_ERR_UNSPEC = 0, IWPM_NLA_ERR_SEQ, IWPM_NLA_ERR_CODE, IWPM_NLA_ERR_MAX }; enum { IWPM_NLA_HELLO_UNSPEC = 0, IWPM_NLA_HELLO_ABI_VERSION, IWPM_NLA_HELLO_MAX }; /* For RDMA_NLDEV_ATTR_DEV_NODE_TYPE */ enum { /* IB values map to NodeInfo:NodeType. */ RDMA_NODE_IB_CA = 1, RDMA_NODE_IB_SWITCH, RDMA_NODE_IB_ROUTER, RDMA_NODE_RNIC, RDMA_NODE_USNIC, RDMA_NODE_USNIC_UDP, RDMA_NODE_UNSPECIFIED, }; /* * Local service operations: * RESOLVE - The client requests the local service to resolve a path. * SET_TIMEOUT - The local service requests the client to set the timeout. * IP_RESOLVE - The client requests the local service to resolve an IP to GID. */ enum { RDMA_NL_LS_OP_RESOLVE = 0, RDMA_NL_LS_OP_SET_TIMEOUT, RDMA_NL_LS_OP_IP_RESOLVE, RDMA_NL_LS_NUM_OPS }; /* Local service netlink message flags */ #define RDMA_NL_LS_F_ERR 0x0100 /* Failed response */ /* * Local service resolve operation family header. * The layout for the resolve operation: * nlmsg header * family header * attributes */ /* * Local service path use: * Specify how the path(s) will be used. * ALL - For connected CM operation (6 pathrecords) * UNIDIRECTIONAL - For unidirectional UD (1 pathrecord) * GMP - For miscellaneous GMP like operation (at least 1 reversible * pathrecord) */ enum { LS_RESOLVE_PATH_USE_ALL = 0, LS_RESOLVE_PATH_USE_UNIDIRECTIONAL, LS_RESOLVE_PATH_USE_GMP, LS_RESOLVE_PATH_USE_MAX }; #define LS_DEVICE_NAME_MAX 64 struct rdma_ls_resolve_header { __u8 device_name[LS_DEVICE_NAME_MAX]; __u8 port_num; __u8 path_use; }; struct rdma_ls_ip_resolve_header { __u32 ifindex; }; /* Local service attribute type */ #define RDMA_NLA_F_MANDATORY (1 << 13) #define RDMA_NLA_TYPE_MASK (~(NLA_F_NESTED | NLA_F_NET_BYTEORDER | \ RDMA_NLA_F_MANDATORY)) /* * Local service attributes: * Attr Name Size Byte order * ----------------------------------------------------- * PATH_RECORD struct ib_path_rec_data * TIMEOUT u32 cpu * SERVICE_ID u64 cpu * DGID u8[16] BE * SGID u8[16] BE * TCLASS u8 * PKEY u16 cpu * QOS_CLASS u16 cpu * IPV4 u32 BE * IPV6 u8[16] BE */ enum { LS_NLA_TYPE_UNSPEC = 0, LS_NLA_TYPE_PATH_RECORD, LS_NLA_TYPE_TIMEOUT, LS_NLA_TYPE_SERVICE_ID, LS_NLA_TYPE_DGID, LS_NLA_TYPE_SGID, LS_NLA_TYPE_TCLASS, LS_NLA_TYPE_PKEY, LS_NLA_TYPE_QOS_CLASS, LS_NLA_TYPE_IPV4, LS_NLA_TYPE_IPV6, LS_NLA_TYPE_MAX }; /* Local service DGID/SGID attribute: big endian */ struct rdma_nla_ls_gid { __u8 gid[16]; }; enum rdma_nldev_command { RDMA_NLDEV_CMD_UNSPEC, RDMA_NLDEV_CMD_GET, /* can dump */ RDMA_NLDEV_CMD_SET, RDMA_NLDEV_CMD_NEWLINK, RDMA_NLDEV_CMD_DELLINK, RDMA_NLDEV_CMD_PORT_GET, /* can dump */ RDMA_NLDEV_CMD_SYS_GET, RDMA_NLDEV_CMD_SYS_SET, /* 8 is free to use */ RDMA_NLDEV_CMD_RES_GET = 9, /* can dump */ RDMA_NLDEV_CMD_RES_QP_GET, /* can dump */ RDMA_NLDEV_CMD_RES_CM_ID_GET, /* can dump */ RDMA_NLDEV_CMD_RES_CQ_GET, /* can dump */ RDMA_NLDEV_CMD_RES_MR_GET, /* can dump */ RDMA_NLDEV_CMD_RES_PD_GET, /* can dump */ RDMA_NLDEV_CMD_GET_CHARDEV, RDMA_NLDEV_CMD_STAT_SET, RDMA_NLDEV_CMD_STAT_GET, /* can dump */ RDMA_NLDEV_CMD_STAT_DEL, RDMA_NLDEV_CMD_RES_QP_GET_RAW, RDMA_NLDEV_CMD_RES_CQ_GET_RAW, RDMA_NLDEV_CMD_RES_MR_GET_RAW, RDMA_NLDEV_CMD_RES_CTX_GET, /* can dump */ RDMA_NLDEV_CMD_RES_SRQ_GET, /* can dump */ RDMA_NLDEV_CMD_STAT_GET_STATUS, RDMA_NLDEV_NUM_OPS }; enum rdma_nldev_print_type { RDMA_NLDEV_PRINT_TYPE_UNSPEC, RDMA_NLDEV_PRINT_TYPE_HEX, }; enum rdma_nldev_attr { /* don't change the order or add anything between, this is ABI! */ RDMA_NLDEV_ATTR_UNSPEC, /* Pad attribute for 64b alignment */ RDMA_NLDEV_ATTR_PAD = RDMA_NLDEV_ATTR_UNSPEC, /* Identifier for ib_device */ RDMA_NLDEV_ATTR_DEV_INDEX, /* u32 */ RDMA_NLDEV_ATTR_DEV_NAME, /* string */ /* * Device index together with port index are identifiers * for port/link properties. * * For RDMA_NLDEV_CMD_GET commamnd, port index will return number * of available ports in ib_device, while for port specific operations, * it will be real port index as it appears in sysfs. Port index follows * sysfs notation and starts from 1 for the first port. */ RDMA_NLDEV_ATTR_PORT_INDEX, /* u32 */ /* * Device and port capabilities * * When used for port info, first 32-bits are CapabilityMask followed by * 16-bit CapabilityMask2. */ RDMA_NLDEV_ATTR_CAP_FLAGS, /* u64 */ /* * FW version */ RDMA_NLDEV_ATTR_FW_VERSION, /* string */ /* * Node GUID (in host byte order) associated with the RDMA device. */ RDMA_NLDEV_ATTR_NODE_GUID, /* u64 */ /* * System image GUID (in host byte order) associated with * this RDMA device and other devices which are part of a * single system. */ RDMA_NLDEV_ATTR_SYS_IMAGE_GUID, /* u64 */ /* * Subnet prefix (in host byte order) */ RDMA_NLDEV_ATTR_SUBNET_PREFIX, /* u64 */ /* * Local Identifier (LID), * According to IB specification, It is 16-bit address assigned * by the Subnet Manager. Extended to be 32-bit for OmniPath users. */ RDMA_NLDEV_ATTR_LID, /* u32 */ RDMA_NLDEV_ATTR_SM_LID, /* u32 */ /* * LID mask control (LMC) */ RDMA_NLDEV_ATTR_LMC, /* u8 */ RDMA_NLDEV_ATTR_PORT_STATE, /* u8 */ RDMA_NLDEV_ATTR_PORT_PHYS_STATE, /* u8 */ RDMA_NLDEV_ATTR_DEV_NODE_TYPE, /* u8 */ RDMA_NLDEV_ATTR_RES_SUMMARY, /* nested table */ RDMA_NLDEV_ATTR_RES_SUMMARY_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_RES_SUMMARY_ENTRY_NAME, /* string */ RDMA_NLDEV_ATTR_RES_SUMMARY_ENTRY_CURR, /* u64 */ RDMA_NLDEV_ATTR_RES_QP, /* nested table */ RDMA_NLDEV_ATTR_RES_QP_ENTRY, /* nested table */ /* * Local QPN */ RDMA_NLDEV_ATTR_RES_LQPN, /* u32 */ /* * Remote QPN, * Applicable for RC and UC only IBTA 11.2.5.3 QUERY QUEUE PAIR */ RDMA_NLDEV_ATTR_RES_RQPN, /* u32 */ /* * Receive Queue PSN, * Applicable for RC and UC only 11.2.5.3 QUERY QUEUE PAIR */ RDMA_NLDEV_ATTR_RES_RQ_PSN, /* u32 */ /* * Send Queue PSN */ RDMA_NLDEV_ATTR_RES_SQ_PSN, /* u32 */ RDMA_NLDEV_ATTR_RES_PATH_MIG_STATE, /* u8 */ /* * QP types as visible to RDMA/core, the reserved QPT * are not exported through this interface. */ RDMA_NLDEV_ATTR_RES_TYPE, /* u8 */ RDMA_NLDEV_ATTR_RES_STATE, /* u8 */ /* * Process ID which created object, * in case of kernel origin, PID won't exist. */ RDMA_NLDEV_ATTR_RES_PID, /* u32 */ /* * The name of process created following resource. * It will exist only for kernel objects. * For user created objects, the user is supposed * to read /proc/PID/comm file. */ RDMA_NLDEV_ATTR_RES_KERN_NAME, /* string */ RDMA_NLDEV_ATTR_RES_CM_ID, /* nested table */ RDMA_NLDEV_ATTR_RES_CM_ID_ENTRY, /* nested table */ /* * rdma_cm_id port space. */ RDMA_NLDEV_ATTR_RES_PS, /* u32 */ /* * Source and destination socket addresses */ RDMA_NLDEV_ATTR_RES_SRC_ADDR, /* __kernel_sockaddr_storage */ RDMA_NLDEV_ATTR_RES_DST_ADDR, /* __kernel_sockaddr_storage */ RDMA_NLDEV_ATTR_RES_CQ, /* nested table */ RDMA_NLDEV_ATTR_RES_CQ_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_RES_CQE, /* u32 */ RDMA_NLDEV_ATTR_RES_USECNT, /* u64 */ RDMA_NLDEV_ATTR_RES_POLL_CTX, /* u8 */ RDMA_NLDEV_ATTR_RES_MR, /* nested table */ RDMA_NLDEV_ATTR_RES_MR_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_RES_RKEY, /* u32 */ RDMA_NLDEV_ATTR_RES_LKEY, /* u32 */ RDMA_NLDEV_ATTR_RES_IOVA, /* u64 */ RDMA_NLDEV_ATTR_RES_MRLEN, /* u64 */ RDMA_NLDEV_ATTR_RES_PD, /* nested table */ RDMA_NLDEV_ATTR_RES_PD_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_RES_LOCAL_DMA_LKEY, /* u32 */ RDMA_NLDEV_ATTR_RES_UNSAFE_GLOBAL_RKEY, /* u32 */ /* * Provides logical name and index of netdevice which is * connected to physical port. This information is relevant * for RoCE and iWARP. * * The netdevices which are associated with containers are * supposed to be exported together with GID table once it * will be exposed through the netlink. Because the * associated netdevices are properties of GIDs. */ RDMA_NLDEV_ATTR_NDEV_INDEX, /* u32 */ RDMA_NLDEV_ATTR_NDEV_NAME, /* string */ /* * driver-specific attributes. */ RDMA_NLDEV_ATTR_DRIVER, /* nested table */ RDMA_NLDEV_ATTR_DRIVER_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_DRIVER_STRING, /* string */ /* * u8 values from enum rdma_nldev_print_type */ RDMA_NLDEV_ATTR_DRIVER_PRINT_TYPE, /* u8 */ RDMA_NLDEV_ATTR_DRIVER_S32, /* s32 */ RDMA_NLDEV_ATTR_DRIVER_U32, /* u32 */ RDMA_NLDEV_ATTR_DRIVER_S64, /* s64 */ RDMA_NLDEV_ATTR_DRIVER_U64, /* u64 */ /* * Indexes to get/set secific entry, * for QP use RDMA_NLDEV_ATTR_RES_LQPN */ RDMA_NLDEV_ATTR_RES_PDN, /* u32 */ RDMA_NLDEV_ATTR_RES_CQN, /* u32 */ RDMA_NLDEV_ATTR_RES_MRN, /* u32 */ RDMA_NLDEV_ATTR_RES_CM_IDN, /* u32 */ RDMA_NLDEV_ATTR_RES_CTXN, /* u32 */ /* * Identifies the rdma driver. eg: "rxe" or "siw" */ RDMA_NLDEV_ATTR_LINK_TYPE, /* string */ /* * net namespace mode for rdma subsystem: * either shared or exclusive among multiple net namespaces. */ RDMA_NLDEV_SYS_ATTR_NETNS_MODE, /* u8 */ /* * Device protocol, e.g. ib, iw, usnic, roce and opa */ RDMA_NLDEV_ATTR_DEV_PROTOCOL, /* string */ /* * File descriptor handle of the net namespace object */ RDMA_NLDEV_NET_NS_FD, /* u32 */ /* * Information about a chardev. * CHARDEV_TYPE is the name of the chardev ABI (ie uverbs, umad, etc) * CHARDEV_ABI signals the ABI revision (historical) * CHARDEV_NAME is the kernel name for the /dev/ file (no directory) * CHARDEV is the 64 bit dev_t for the inode */ RDMA_NLDEV_ATTR_CHARDEV_TYPE, /* string */ RDMA_NLDEV_ATTR_CHARDEV_NAME, /* string */ RDMA_NLDEV_ATTR_CHARDEV_ABI, /* u64 */ RDMA_NLDEV_ATTR_CHARDEV, /* u64 */ RDMA_NLDEV_ATTR_UVERBS_DRIVER_ID, /* u64 */ /* * Counter-specific attributes. */ RDMA_NLDEV_ATTR_STAT_MODE, /* u32 */ RDMA_NLDEV_ATTR_STAT_RES, /* u32 */ RDMA_NLDEV_ATTR_STAT_AUTO_MODE_MASK, /* u32 */ RDMA_NLDEV_ATTR_STAT_COUNTER, /* nested table */ RDMA_NLDEV_ATTR_STAT_COUNTER_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_STAT_COUNTER_ID, /* u32 */ RDMA_NLDEV_ATTR_STAT_HWCOUNTERS, /* nested table */ RDMA_NLDEV_ATTR_STAT_HWCOUNTER_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_STAT_HWCOUNTER_ENTRY_NAME, /* string */ RDMA_NLDEV_ATTR_STAT_HWCOUNTER_ENTRY_VALUE, /* u64 */ /* * CQ adaptive moderatio (DIM) */ RDMA_NLDEV_ATTR_DEV_DIM, /* u8 */ RDMA_NLDEV_ATTR_RES_RAW, /* binary */ RDMA_NLDEV_ATTR_RES_CTX, /* nested table */ RDMA_NLDEV_ATTR_RES_CTX_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_RES_SRQ, /* nested table */ RDMA_NLDEV_ATTR_RES_SRQ_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_RES_SRQN, /* u32 */ RDMA_NLDEV_ATTR_MIN_RANGE, /* u32 */ RDMA_NLDEV_ATTR_MAX_RANGE, /* u32 */ RDMA_NLDEV_SYS_ATTR_COPY_ON_FORK, /* u8 */ RDMA_NLDEV_ATTR_STAT_HWCOUNTER_INDEX, /* u32 */ RDMA_NLDEV_ATTR_STAT_HWCOUNTER_DYNAMIC, /* u8 */ /* * Always the end */ RDMA_NLDEV_ATTR_MAX }; /* * Supported counter bind modes. All modes are mutual-exclusive. */ enum rdma_nl_counter_mode { RDMA_COUNTER_MODE_NONE, /* * A qp is bound with a counter automatically during initialization * based on the auto mode (e.g., qp type, ...) */ RDMA_COUNTER_MODE_AUTO, /* * Which qp are bound with which counter is explicitly specified * by the user */ RDMA_COUNTER_MODE_MANUAL, /* * Always the end */ RDMA_COUNTER_MODE_MAX, }; /* * Supported criteria in counter auto mode. * Currently only "qp type" is supported */ enum rdma_nl_counter_mask { RDMA_COUNTER_MASK_QP_TYPE = 1, RDMA_COUNTER_MASK_PID = 1 << 1, }; #endif /* _RDMA_NETLINK_H */ rdma_user_cm.h000064400000015734151703010350007362 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2005-2006 Intel Corporation. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef RDMA_USER_CM_H #define RDMA_USER_CM_H #include <linux/types.h> #include <linux/socket.h> #include <linux/in6.h> #include <rdma/ib_user_verbs.h> #include <rdma/ib_user_sa.h> #define RDMA_USER_CM_ABI_VERSION 4 #define RDMA_MAX_PRIVATE_DATA 256 enum { RDMA_USER_CM_CMD_CREATE_ID, RDMA_USER_CM_CMD_DESTROY_ID, RDMA_USER_CM_CMD_BIND_IP, RDMA_USER_CM_CMD_RESOLVE_IP, RDMA_USER_CM_CMD_RESOLVE_ROUTE, RDMA_USER_CM_CMD_QUERY_ROUTE, RDMA_USER_CM_CMD_CONNECT, RDMA_USER_CM_CMD_LISTEN, RDMA_USER_CM_CMD_ACCEPT, RDMA_USER_CM_CMD_REJECT, RDMA_USER_CM_CMD_DISCONNECT, RDMA_USER_CM_CMD_INIT_QP_ATTR, RDMA_USER_CM_CMD_GET_EVENT, RDMA_USER_CM_CMD_GET_OPTION, RDMA_USER_CM_CMD_SET_OPTION, RDMA_USER_CM_CMD_NOTIFY, RDMA_USER_CM_CMD_JOIN_IP_MCAST, RDMA_USER_CM_CMD_LEAVE_MCAST, RDMA_USER_CM_CMD_MIGRATE_ID, RDMA_USER_CM_CMD_QUERY, RDMA_USER_CM_CMD_BIND, RDMA_USER_CM_CMD_RESOLVE_ADDR, RDMA_USER_CM_CMD_JOIN_MCAST }; /* See IBTA Annex A11, servies ID bytes 4 & 5 */ enum rdma_ucm_port_space { RDMA_PS_IPOIB = 0x0002, RDMA_PS_IB = 0x013F, RDMA_PS_TCP = 0x0106, RDMA_PS_UDP = 0x0111, }; /* * command ABI structures. */ struct rdma_ucm_cmd_hdr { __u32 cmd; __u16 in; __u16 out; }; struct rdma_ucm_create_id { __aligned_u64 uid; __aligned_u64 response; __u16 ps; /* use enum rdma_ucm_port_space */ __u8 qp_type; __u8 reserved[5]; }; struct rdma_ucm_create_id_resp { __u32 id; }; struct rdma_ucm_destroy_id { __aligned_u64 response; __u32 id; __u32 reserved; }; struct rdma_ucm_destroy_id_resp { __u32 events_reported; }; struct rdma_ucm_bind_ip { __aligned_u64 response; struct sockaddr_in6 addr; __u32 id; }; struct rdma_ucm_bind { __u32 id; __u16 addr_size; __u16 reserved; struct __kernel_sockaddr_storage addr; }; struct rdma_ucm_resolve_ip { struct sockaddr_in6 src_addr; struct sockaddr_in6 dst_addr; __u32 id; __u32 timeout_ms; }; struct rdma_ucm_resolve_addr { __u32 id; __u32 timeout_ms; __u16 src_size; __u16 dst_size; __u32 reserved; struct __kernel_sockaddr_storage src_addr; struct __kernel_sockaddr_storage dst_addr; }; struct rdma_ucm_resolve_route { __u32 id; __u32 timeout_ms; }; enum { RDMA_USER_CM_QUERY_ADDR, RDMA_USER_CM_QUERY_PATH, RDMA_USER_CM_QUERY_GID }; struct rdma_ucm_query { __aligned_u64 response; __u32 id; __u32 option; }; struct rdma_ucm_query_route_resp { __aligned_u64 node_guid; struct ib_user_path_rec ib_route[2]; struct sockaddr_in6 src_addr; struct sockaddr_in6 dst_addr; __u32 num_paths; __u8 port_num; __u8 reserved[3]; __u32 ibdev_index; __u32 reserved1; }; struct rdma_ucm_query_addr_resp { __aligned_u64 node_guid; __u8 port_num; __u8 reserved; __u16 pkey; __u16 src_size; __u16 dst_size; struct __kernel_sockaddr_storage src_addr; struct __kernel_sockaddr_storage dst_addr; __u32 ibdev_index; __u32 reserved1; }; struct rdma_ucm_query_path_resp { __u32 num_paths; __u32 reserved; struct ib_path_rec_data path_data[]; }; struct rdma_ucm_conn_param { __u32 qp_num; __u32 qkey; __u8 private_data[RDMA_MAX_PRIVATE_DATA]; __u8 private_data_len; __u8 srq; __u8 responder_resources; __u8 initiator_depth; __u8 flow_control; __u8 retry_count; __u8 rnr_retry_count; __u8 valid; }; struct rdma_ucm_ud_param { __u32 qp_num; __u32 qkey; struct ib_uverbs_ah_attr ah_attr; __u8 private_data[RDMA_MAX_PRIVATE_DATA]; __u8 private_data_len; __u8 reserved[7]; }; struct rdma_ucm_ece { __u32 vendor_id; __u32 attr_mod; }; struct rdma_ucm_connect { struct rdma_ucm_conn_param conn_param; __u32 id; __u32 reserved; struct rdma_ucm_ece ece; }; struct rdma_ucm_listen { __u32 id; __u32 backlog; }; struct rdma_ucm_accept { __aligned_u64 uid; struct rdma_ucm_conn_param conn_param; __u32 id; __u32 reserved; struct rdma_ucm_ece ece; }; struct rdma_ucm_reject { __u32 id; __u8 private_data_len; __u8 reason; __u8 reserved[2]; __u8 private_data[RDMA_MAX_PRIVATE_DATA]; }; struct rdma_ucm_disconnect { __u32 id; }; struct rdma_ucm_init_qp_attr { __aligned_u64 response; __u32 id; __u32 qp_state; }; struct rdma_ucm_notify { __u32 id; __u32 event; }; struct rdma_ucm_join_ip_mcast { __aligned_u64 response; /* rdma_ucm_create_id_resp */ __aligned_u64 uid; struct sockaddr_in6 addr; __u32 id; }; /* Multicast join flags */ enum { RDMA_MC_JOIN_FLAG_FULLMEMBER, RDMA_MC_JOIN_FLAG_SENDONLY_FULLMEMBER, RDMA_MC_JOIN_FLAG_RESERVED, }; struct rdma_ucm_join_mcast { __aligned_u64 response; /* rdma_ucma_create_id_resp */ __aligned_u64 uid; __u32 id; __u16 addr_size; __u16 join_flags; struct __kernel_sockaddr_storage addr; }; struct rdma_ucm_get_event { __aligned_u64 response; }; struct rdma_ucm_event_resp { __aligned_u64 uid; __u32 id; __u32 event; __u32 status; /* * NOTE: This union is not aligned to 8 bytes so none of the union * members may contain a u64 or anything with higher alignment than 4. */ union { struct rdma_ucm_conn_param conn; struct rdma_ucm_ud_param ud; } param; __u32 reserved; struct rdma_ucm_ece ece; }; /* Option levels */ enum { RDMA_OPTION_ID = 0, RDMA_OPTION_IB = 1 }; /* Option details */ enum { RDMA_OPTION_ID_TOS = 0, RDMA_OPTION_ID_REUSEADDR = 1, RDMA_OPTION_ID_AFONLY = 2, RDMA_OPTION_ID_ACK_TIMEOUT = 3 }; enum { RDMA_OPTION_IB_PATH = 1 }; struct rdma_ucm_set_option { __aligned_u64 optval; __u32 id; __u32 level; __u32 optname; __u32 optlen; }; struct rdma_ucm_migrate_id { __aligned_u64 response; __u32 id; __u32 fd; }; struct rdma_ucm_migrate_resp { __u32 events_reported; }; #endif /* RDMA_USER_CM_H */ rdma_user_ioctl.h000064400000007247151703010350010075 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2016 Mellanox Technologies, LTD. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef RDMA_USER_IOCTL_H #define RDMA_USER_IOCTL_H #include <rdma/ib_user_mad.h> #include <rdma/hfi/hfi1_ioctl.h> #include <rdma/rdma_user_ioctl_cmds.h> /* Legacy name, for user space application which already use it */ #define IB_IOCTL_MAGIC RDMA_IOCTL_MAGIC /* * General blocks assignments * It is closed on purpose - do not expose it to user space * #define MAD_CMD_BASE 0x00 * #define HFI1_CMD_BAS 0xE0 */ /* MAD specific section */ #define IB_USER_MAD_REGISTER_AGENT _IOWR(RDMA_IOCTL_MAGIC, 0x01, struct ib_user_mad_reg_req) #define IB_USER_MAD_UNREGISTER_AGENT _IOW(RDMA_IOCTL_MAGIC, 0x02, __u32) #define IB_USER_MAD_ENABLE_PKEY _IO(RDMA_IOCTL_MAGIC, 0x03) #define IB_USER_MAD_REGISTER_AGENT2 _IOWR(RDMA_IOCTL_MAGIC, 0x04, struct ib_user_mad_reg_req2) /* HFI specific section */ /* allocate HFI and context */ #define HFI1_IOCTL_ASSIGN_CTXT _IOWR(RDMA_IOCTL_MAGIC, 0xE1, struct hfi1_user_info) /* find out what resources we got */ #define HFI1_IOCTL_CTXT_INFO _IOW(RDMA_IOCTL_MAGIC, 0xE2, struct hfi1_ctxt_info) /* set up userspace */ #define HFI1_IOCTL_USER_INFO _IOW(RDMA_IOCTL_MAGIC, 0xE3, struct hfi1_base_info) /* update expected TID entries */ #define HFI1_IOCTL_TID_UPDATE _IOWR(RDMA_IOCTL_MAGIC, 0xE4, struct hfi1_tid_info) /* free expected TID entries */ #define HFI1_IOCTL_TID_FREE _IOWR(RDMA_IOCTL_MAGIC, 0xE5, struct hfi1_tid_info) /* force an update of PIO credit */ #define HFI1_IOCTL_CREDIT_UPD _IO(RDMA_IOCTL_MAGIC, 0xE6) /* control receipt of packets */ #define HFI1_IOCTL_RECV_CTRL _IOW(RDMA_IOCTL_MAGIC, 0xE8, int) /* set the kind of polling we want */ #define HFI1_IOCTL_POLL_TYPE _IOW(RDMA_IOCTL_MAGIC, 0xE9, int) /* ack & clear user status bits */ #define HFI1_IOCTL_ACK_EVENT _IOW(RDMA_IOCTL_MAGIC, 0xEA, unsigned long) /* set context's pkey */ #define HFI1_IOCTL_SET_PKEY _IOW(RDMA_IOCTL_MAGIC, 0xEB, __u16) /* reset context's HW send context */ #define HFI1_IOCTL_CTXT_RESET _IO(RDMA_IOCTL_MAGIC, 0xEC) /* read TID cache invalidations */ #define HFI1_IOCTL_TID_INVAL_READ _IOWR(RDMA_IOCTL_MAGIC, 0xED, struct hfi1_tid_info) /* get the version of the user cdev */ #define HFI1_IOCTL_GET_VERS _IOR(RDMA_IOCTL_MAGIC, 0xEE, int) #endif /* RDMA_USER_IOCTL_H */ rdma_user_ioctl_cmds.h000064400000005057151703010350011100 0ustar00/* * Copyright (c) 2018, Mellanox Technologies inc. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef RDMA_USER_IOCTL_CMDS_H #define RDMA_USER_IOCTL_CMDS_H #include <linux/types.h> #include <linux/ioctl.h> /* Documentation/ioctl/ioctl-number.txt */ #define RDMA_IOCTL_MAGIC 0x1b #define RDMA_VERBS_IOCTL \ _IOWR(RDMA_IOCTL_MAGIC, 1, struct ib_uverbs_ioctl_hdr) enum { /* User input */ UVERBS_ATTR_F_MANDATORY = 1U << 0, /* * Valid output bit should be ignored and considered set in * mandatory fields. This bit is kernel output. */ UVERBS_ATTR_F_VALID_OUTPUT = 1U << 1, }; struct ib_uverbs_attr { __u16 attr_id; /* command specific type attribute */ __u16 len; /* only for pointers and IDRs array */ __u16 flags; /* combination of UVERBS_ATTR_F_XXXX */ union { struct { __u8 elem_id; __u8 reserved; } enum_data; __u16 reserved; } attr_data; union { /* * ptr to command, __inline__ data, idr/fd or * ptr to __u32 array of IDRs */ __aligned_u64 data; /* Used by FD_IN and FD_OUT */ __s64 data_s64; }; }; struct ib_uverbs_ioctl_hdr { __u16 length; __u16 object_id; __u16 method_id; __u16 num_attrs; __aligned_u64 reserved1; __u32 driver_id; __u32 reserved2; struct ib_uverbs_attr attrs[]; }; #endif rdma_user_rxe.h000064400000011253151703010350007551 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2016 Mellanox Technologies Ltd. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef RDMA_USER_RXE_H #define RDMA_USER_RXE_H #include <linux/types.h> #include <linux/socket.h> #include <linux/in.h> #include <linux/in6.h> enum { RXE_NETWORK_TYPE_IPV4 = 1, RXE_NETWORK_TYPE_IPV6 = 2, }; union rxe_gid { __u8 raw[16]; struct { __be64 subnet_prefix; __be64 interface_id; } global; }; struct rxe_global_route { union rxe_gid dgid; __u32 flow_label; __u8 sgid_index; __u8 hop_limit; __u8 traffic_class; }; struct rxe_av { __u8 port_num; /* From RXE_NETWORK_TYPE_* */ __u8 network_type; __u8 dmac[6]; struct rxe_global_route grh; union { struct sockaddr_in _sockaddr_in; struct sockaddr_in6 _sockaddr_in6; } sgid_addr, dgid_addr; }; struct rxe_send_wr { __aligned_u64 wr_id; __u32 num_sge; __u32 opcode; __u32 send_flags; union { __be32 imm_data; __u32 invalidate_rkey; } ex; union { struct { __aligned_u64 remote_addr; __u32 rkey; __u32 reserved; } rdma; struct { __aligned_u64 remote_addr; __aligned_u64 compare_add; __aligned_u64 swap; __u32 rkey; __u32 reserved; } atomic; struct { __u32 remote_qpn; __u32 remote_qkey; __u16 pkey_index; __u16 reserved; __u32 ah_num; __u32 pad[4]; struct rxe_av av; } ud; struct { __aligned_u64 addr; __aligned_u64 length; __u32 mr_lkey; __u32 mw_rkey; __u32 rkey; __u32 access; } mw; /* reg is only used by the kernel and is not part of the uapi */ } wr; }; struct rxe_sge { __aligned_u64 addr; __u32 length; __u32 lkey; }; struct mminfo { __aligned_u64 offset; __u32 size; __u32 pad; }; struct rxe_dma_info { __u32 length; __u32 resid; __u32 cur_sge; __u32 num_sge; __u32 sge_offset; __u32 reserved; union { __u8 inline_data[0]; struct rxe_sge sge[0]; }; }; struct rxe_send_wqe { struct rxe_send_wr wr; __u32 status; __u32 state; __aligned_u64 iova; __u32 mask; __u32 first_psn; __u32 last_psn; __u32 ack_length; __u32 ssn; __u32 has_rd_atomic; struct rxe_dma_info dma; }; struct rxe_recv_wqe { __aligned_u64 wr_id; __u32 num_sge; __u32 padding; struct rxe_dma_info dma; }; struct rxe_create_ah_resp { __u32 ah_num; __u32 reserved; }; struct rxe_create_cq_resp { struct mminfo mi; }; struct rxe_resize_cq_resp { struct mminfo mi; }; struct rxe_create_qp_resp { struct mminfo rq_mi; struct mminfo sq_mi; }; struct rxe_create_srq_resp { struct mminfo mi; __u32 srq_num; __u32 reserved; }; struct rxe_modify_srq_cmd { __aligned_u64 mmap_info_addr; }; /* This data structure is stored at the base of work and * completion queues shared between user space and kernel space. * It contains the producer and consumer indices. Is also * contains a copy of the queue size parameters for user space * to use but the kernel must use the parameters in the * rxe_queue struct. For performance reasons arrange to have * producer and consumer indices in separate cache lines * the kernel should always mask the indices to avoid accessing * memory outside of the data area */ struct rxe_queue_buf { __u32 log2_elem_size; __u32 index_mask; __u32 pad_1[30]; __u32 producer_index; __u32 pad_2[31]; __u32 consumer_index; __u32 pad_3[31]; __u8 data[]; }; #endif /* RDMA_USER_RXE_H */ rvt-abi.h000064400000003321151703010350006253 0ustar00/* SPDX-License-Identifier: (GPL-2.0 OR BSD-3-Clause) */ /* * This file contains defines, structures, etc. that are used * to communicate between kernel and user code. */ #ifndef RVT_ABI_USER_H #define RVT_ABI_USER_H #include <linux/types.h> #include <rdma/ib_user_verbs.h> #ifndef RDMA_ATOMIC_UAPI #define RDMA_ATOMIC_UAPI(_type, _name) struct{ _type val; } _name #endif struct rvt_wqe_sge { __aligned_u64 addr; __u32 length; __u32 lkey; }; /* * This structure is used to contain the head pointer, tail pointer, * and completion queue entries as a single memory allocation so * it can be mmap'ed into user space. */ struct rvt_cq_wc { /* index of next entry to fill */ RDMA_ATOMIC_UAPI(__u32, head); /* index of next ib_poll_cq() entry */ RDMA_ATOMIC_UAPI(__u32, tail); /* these are actually size ibcq.cqe + 1 */ struct ib_uverbs_wc uqueue[]; }; /* * Receive work request queue entry. * The size of the sg_list is determined when the QP (or SRQ) is created * and stored in qp->r_rq.max_sge (or srq->rq.max_sge). */ struct rvt_rwqe { __u64 wr_id; __u8 num_sge; __u8 padding[7]; struct rvt_wqe_sge sg_list[]; }; /* * This structure is used to contain the head pointer, tail pointer, * and receive work queue entries as a single memory allocation so * it can be mmap'ed into user space. * Note that the wq array elements are variable size so you can't * just index into the array to get the N'th element; * use get_rwqe_ptr() for user space and rvt_get_rwqe_ptr() * for kernel space. */ struct rvt_rwq { /* new work requests posted to the head */ RDMA_ATOMIC_UAPI(__u32, head); /* receives pull requests from here. */ RDMA_ATOMIC_UAPI(__u32, tail); struct rvt_rwqe wq[]; }; #endif /* RVT_ABI_USER_H */ siw-abi.h000064400000006514151703010350006251 0ustar00/* SPDX-License-Identifier: GPL-2.0 or BSD-3-Clause */ /* Authors: Bernard Metzler <bmt@zurich.ibm.com> */ /* Copyright (c) 2008-2019, IBM Corporation */ #ifndef _SIW_USER_H #define _SIW_USER_H #include <linux/types.h> #define SIW_NODE_DESC_COMMON "Software iWARP stack" #define SIW_ABI_VERSION 1 #define SIW_MAX_SGE 6 #define SIW_UOBJ_MAX_KEY 0x08FFFF #define SIW_INVAL_UOBJ_KEY (SIW_UOBJ_MAX_KEY + 1) struct siw_uresp_create_cq { __u32 cq_id; __u32 num_cqe; __aligned_u64 cq_key; }; struct siw_uresp_create_qp { __u32 qp_id; __u32 num_sqe; __u32 num_rqe; __u32 pad; __aligned_u64 sq_key; __aligned_u64 rq_key; }; struct siw_ureq_reg_mr { __u8 stag_key; __u8 reserved[3]; __u32 pad; }; struct siw_uresp_reg_mr { __u32 stag; __u32 pad; }; struct siw_uresp_create_srq { __u32 num_rqe; __u32 pad; __aligned_u64 srq_key; }; struct siw_uresp_alloc_ctx { __u32 dev_id; __u32 pad; }; enum siw_opcode { SIW_OP_WRITE, SIW_OP_READ, SIW_OP_READ_LOCAL_INV, SIW_OP_SEND, SIW_OP_SEND_WITH_IMM, SIW_OP_SEND_REMOTE_INV, /* Unsupported */ SIW_OP_FETCH_AND_ADD, SIW_OP_COMP_AND_SWAP, SIW_OP_RECEIVE, /* provider internal SQE */ SIW_OP_READ_RESPONSE, /* * below opcodes valid for * in-kernel clients only */ SIW_OP_INVAL_STAG, SIW_OP_REG_MR, SIW_NUM_OPCODES }; /* Keep it same as ibv_sge to allow for memcpy */ struct siw_sge { __aligned_u64 laddr; __u32 length; __u32 lkey; }; /* * Inline data are kept within the work request itself occupying * the space of sge[1] .. sge[n]. Therefore, __inline__ data cannot be * supported if SIW_MAX_SGE is below 2 elements. */ #define SIW_MAX_INLINE (sizeof(struct siw_sge) * (SIW_MAX_SGE - 1)) #if SIW_MAX_SGE < 2 #error "SIW_MAX_SGE must be at least 2" #endif enum siw_wqe_flags { SIW_WQE_VALID = 1, SIW_WQE_INLINE = (1 << 1), SIW_WQE_SIGNALLED = (1 << 2), SIW_WQE_SOLICITED = (1 << 3), SIW_WQE_READ_FENCE = (1 << 4), SIW_WQE_REM_INVAL = (1 << 5), SIW_WQE_COMPLETED = (1 << 6) }; /* Send Queue Element */ struct siw_sqe { __aligned_u64 id; __u16 flags; __u8 num_sge; /* Contains enum siw_opcode values */ __u8 opcode; __u32 rkey; union { __aligned_u64 raddr; __aligned_u64 base_mr; }; union { struct siw_sge sge[SIW_MAX_SGE]; __aligned_u64 access; }; }; /* Receive Queue Element */ struct siw_rqe { __aligned_u64 id; __u16 flags; __u8 num_sge; /* * only used by kernel driver, * ignored if set by user */ __u8 opcode; __u32 unused; struct siw_sge sge[SIW_MAX_SGE]; }; enum siw_notify_flags { SIW_NOTIFY_NOT = (0), SIW_NOTIFY_SOLICITED = (1 << 0), SIW_NOTIFY_NEXT_COMPLETION = (1 << 1), SIW_NOTIFY_MISSED_EVENTS = (1 << 2), SIW_NOTIFY_ALL = SIW_NOTIFY_SOLICITED | SIW_NOTIFY_NEXT_COMPLETION | SIW_NOTIFY_MISSED_EVENTS }; enum siw_wc_status { SIW_WC_SUCCESS, SIW_WC_LOC_LEN_ERR, SIW_WC_LOC_PROT_ERR, SIW_WC_LOC_QP_OP_ERR, SIW_WC_WR_FLUSH_ERR, SIW_WC_BAD_RESP_ERR, SIW_WC_LOC_ACCESS_ERR, SIW_WC_REM_ACCESS_ERR, SIW_WC_REM_INV_REQ_ERR, SIW_WC_GENERAL_ERR, SIW_NUM_WC_STATUS }; struct siw_cqe { __aligned_u64 id; __u8 flags; __u8 opcode; __u16 status; __u32 bytes; union { __aligned_u64 imm_data; __u32 inval_stag; }; /* QP number or QP pointer */ union { struct ib_qp *base_qp; __aligned_u64 qp_id; }; }; /* * Shared structure between user and kernel * to control CQ arming. */ struct siw_cq_ctrl { __u32 flags; __u32 pad; }; #endif vmw_pvrdma-abi.h000064400000017513151703010350007632 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR BSD-2-Clause) */ /* * Copyright (c) 2012-2016 VMware, Inc. All rights reserved. * * This program is free software; you can redistribute it and/or * modify it under the terms of EITHER the GNU General Public License * version 2 as published by the Free Software Foundation or the BSD * 2-Clause License. This program is distributed in the hope that it * will be useful, but WITHOUT ANY WARRANTY; WITHOUT EVEN THE IMPLIED * WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. * See the GNU General Public License version 2 for more details at * http://www.gnu.org/licenses/old-licenses/gpl-2.0.en.html. * * You should have received a copy of the GNU General Public License * along with this program available in the file COPYING in the main * directory of this source tree. * * The BSD 2-Clause License * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS * FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE * COPYRIGHT HOLDER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, * INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES * (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR * SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) * HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, * STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) * ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED * OF THE POSSIBILITY OF SUCH DAMAGE. */ #ifndef __VMW_PVRDMA_ABI_H__ #define __VMW_PVRDMA_ABI_H__ #include <linux/types.h> #define PVRDMA_UVERBS_ABI_VERSION 3 /* ABI Version. */ #define PVRDMA_UAR_HANDLE_MASK 0x00FFFFFF /* Bottom 24 bits. */ #define PVRDMA_UAR_QP_OFFSET 0 /* QP doorbell. */ #define PVRDMA_UAR_QP_SEND (1 << 30) /* Send bit. */ #define PVRDMA_UAR_QP_RECV (1 << 31) /* Recv bit. */ #define PVRDMA_UAR_CQ_OFFSET 4 /* CQ doorbell. */ #define PVRDMA_UAR_CQ_ARM_SOL (1 << 29) /* Arm solicited bit. */ #define PVRDMA_UAR_CQ_ARM (1 << 30) /* Arm bit. */ #define PVRDMA_UAR_CQ_POLL (1 << 31) /* Poll bit. */ #define PVRDMA_UAR_SRQ_OFFSET 8 /* SRQ doorbell. */ #define PVRDMA_UAR_SRQ_RECV (1 << 30) /* Recv bit. */ enum pvrdma_wr_opcode { PVRDMA_WR_RDMA_WRITE, PVRDMA_WR_RDMA_WRITE_WITH_IMM, PVRDMA_WR_SEND, PVRDMA_WR_SEND_WITH_IMM, PVRDMA_WR_RDMA_READ, PVRDMA_WR_ATOMIC_CMP_AND_SWP, PVRDMA_WR_ATOMIC_FETCH_AND_ADD, PVRDMA_WR_LSO, PVRDMA_WR_SEND_WITH_INV, PVRDMA_WR_RDMA_READ_WITH_INV, PVRDMA_WR_LOCAL_INV, PVRDMA_WR_FAST_REG_MR, PVRDMA_WR_MASKED_ATOMIC_CMP_AND_SWP, PVRDMA_WR_MASKED_ATOMIC_FETCH_AND_ADD, PVRDMA_WR_BIND_MW, PVRDMA_WR_REG_SIG_MR, PVRDMA_WR_ERROR, }; enum pvrdma_wc_status { PVRDMA_WC_SUCCESS, PVRDMA_WC_LOC_LEN_ERR, PVRDMA_WC_LOC_QP_OP_ERR, PVRDMA_WC_LOC_EEC_OP_ERR, PVRDMA_WC_LOC_PROT_ERR, PVRDMA_WC_WR_FLUSH_ERR, PVRDMA_WC_MW_BIND_ERR, PVRDMA_WC_BAD_RESP_ERR, PVRDMA_WC_LOC_ACCESS_ERR, PVRDMA_WC_REM_INV_REQ_ERR, PVRDMA_WC_REM_ACCESS_ERR, PVRDMA_WC_REM_OP_ERR, PVRDMA_WC_RETRY_EXC_ERR, PVRDMA_WC_RNR_RETRY_EXC_ERR, PVRDMA_WC_LOC_RDD_VIOL_ERR, PVRDMA_WC_REM_INV_RD_REQ_ERR, PVRDMA_WC_REM_ABORT_ERR, PVRDMA_WC_INV_EECN_ERR, PVRDMA_WC_INV_EEC_STATE_ERR, PVRDMA_WC_FATAL_ERR, PVRDMA_WC_RESP_TIMEOUT_ERR, PVRDMA_WC_GENERAL_ERR, }; enum pvrdma_wc_opcode { PVRDMA_WC_SEND, PVRDMA_WC_RDMA_WRITE, PVRDMA_WC_RDMA_READ, PVRDMA_WC_COMP_SWAP, PVRDMA_WC_FETCH_ADD, PVRDMA_WC_BIND_MW, PVRDMA_WC_LSO, PVRDMA_WC_LOCAL_INV, PVRDMA_WC_FAST_REG_MR, PVRDMA_WC_MASKED_COMP_SWAP, PVRDMA_WC_MASKED_FETCH_ADD, PVRDMA_WC_RECV = 1 << 7, PVRDMA_WC_RECV_RDMA_WITH_IMM, }; enum pvrdma_wc_flags { PVRDMA_WC_GRH = 1 << 0, PVRDMA_WC_WITH_IMM = 1 << 1, PVRDMA_WC_WITH_INVALIDATE = 1 << 2, PVRDMA_WC_IP_CSUM_OK = 1 << 3, PVRDMA_WC_WITH_SMAC = 1 << 4, PVRDMA_WC_WITH_VLAN = 1 << 5, PVRDMA_WC_WITH_NETWORK_HDR_TYPE = 1 << 6, PVRDMA_WC_FLAGS_MAX = PVRDMA_WC_WITH_NETWORK_HDR_TYPE, }; enum pvrdma_network_type { PVRDMA_NETWORK_IB, PVRDMA_NETWORK_ROCE_V1 = PVRDMA_NETWORK_IB, PVRDMA_NETWORK_IPV4, PVRDMA_NETWORK_IPV6 }; struct pvrdma_alloc_ucontext_resp { __u32 qp_tab_size; __u32 reserved; }; struct pvrdma_alloc_pd_resp { __u32 pdn; __u32 reserved; }; struct pvrdma_create_cq { __aligned_u64 buf_addr; __u32 buf_size; __u32 reserved; }; struct pvrdma_create_cq_resp { __u32 cqn; __u32 reserved; }; struct pvrdma_resize_cq { __aligned_u64 buf_addr; __u32 buf_size; __u32 reserved; }; struct pvrdma_create_srq { __aligned_u64 buf_addr; __u32 buf_size; __u32 reserved; }; struct pvrdma_create_srq_resp { __u32 srqn; __u32 reserved; }; struct pvrdma_create_qp { __aligned_u64 rbuf_addr; __aligned_u64 sbuf_addr; __u32 rbuf_size; __u32 sbuf_size; __aligned_u64 qp_addr; }; struct pvrdma_create_qp_resp { __u32 qpn; __u32 qp_handle; }; /* PVRDMA masked atomic compare and swap */ struct pvrdma_ex_cmp_swap { __aligned_u64 swap_val; __aligned_u64 compare_val; __aligned_u64 swap_mask; __aligned_u64 compare_mask; }; /* PVRDMA masked atomic fetch and add */ struct pvrdma_ex_fetch_add { __aligned_u64 add_val; __aligned_u64 field_boundary; }; /* PVRDMA address vector. */ struct pvrdma_av { __u32 port_pd; __u32 sl_tclass_flowlabel; __u8 dgid[16]; __u8 src_path_bits; __u8 gid_index; __u8 stat_rate; __u8 hop_limit; __u8 dmac[6]; __u8 reserved[6]; }; /* PVRDMA scatter/gather entry */ struct pvrdma_sge { __aligned_u64 addr; __u32 length; __u32 lkey; }; /* PVRDMA receive queue work request */ struct pvrdma_rq_wqe_hdr { __aligned_u64 wr_id; /* wr id */ __u32 num_sge; /* size of s/g array */ __u32 total_len; /* reserved */ }; /* Use pvrdma_sge (ib_sge) for receive queue s/g array elements. */ /* PVRDMA send queue work request */ struct pvrdma_sq_wqe_hdr { __aligned_u64 wr_id; /* wr id */ __u32 num_sge; /* size of s/g array */ __u32 total_len; /* reserved */ __u32 opcode; /* operation type */ __u32 send_flags; /* wr flags */ union { __be32 imm_data; __u32 invalidate_rkey; } ex; __u32 reserved; union { struct { __aligned_u64 remote_addr; __u32 rkey; __u8 reserved[4]; } rdma; struct { __aligned_u64 remote_addr; __aligned_u64 compare_add; __aligned_u64 swap; __u32 rkey; __u32 reserved; } atomic; struct { __aligned_u64 remote_addr; __u32 log_arg_sz; __u32 rkey; union { struct pvrdma_ex_cmp_swap cmp_swap; struct pvrdma_ex_fetch_add fetch_add; } wr_data; } masked_atomics; struct { __aligned_u64 iova_start; __aligned_u64 pl_pdir_dma; __u32 page_shift; __u32 page_list_len; __u32 length; __u32 access_flags; __u32 rkey; __u32 reserved; } fast_reg; struct { __u32 remote_qpn; __u32 remote_qkey; struct pvrdma_av av; } ud; } wr; }; /* Use pvrdma_sge (ib_sge) for send queue s/g array elements. */ /* Completion queue element. */ struct pvrdma_cqe { __aligned_u64 wr_id; __aligned_u64 qp; __u32 opcode; __u32 status; __u32 byte_len; __be32 imm_data; __u32 src_qp; __u32 wc_flags; __u32 vendor_err; __u16 pkey_index; __u16 slid; __u8 sl; __u8 dlid_path_bits; __u8 port_num; __u8 smac[6]; __u8 network_hdr_type; __u8 reserved2[6]; /* Pad to next power of 2 (64). */ }; #endif /* __VMW_PVRDMA_ABI_H__ */
/home/emeraadmin/www/node_modules/tss-react/../object.defaults/../../4d695/rdma.tar